Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.11
PubTator Score 0.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 1.6e-04
atypical teratoid / rhabdoid tumor 1.400 2.3e-04
ependymoma 1.500 2.1e-10
glioblastoma 1.200 7.3e-07
group 3 medulloblastoma 1.300 1.2e-02
medulloblastoma, large-cell 1.100 1.9e-03
osteosarcoma 1.387 6.0e-03
ovarian cancer 1.100 4.0e-04
pediatric high grade glioma 1.500 1.2e-05
primitive neuroectodermal tumor 1.100 1.7e-03

Gene RIF (1)

AA Sequence

MKITRQKHAKKHLGFFRNNFGVREPYQILLDGTFCQAALRGRIQLREQLPRYLMGETQLCTTRCVLKELE      1 - 70
TLGKDLYGAKLIAQKCQVRNCPHFKNAVSGSECLLSMVEEGNPHHYFVATQDQNLSVKVKKKPGVPLMFI     71 - 140
IQNTMVLDKPSPKTIAFVKAVESGQLVSVHEKESIKHLKEEQGLVKNTEQSRRKKRKKISGPNPLSCLKK    141 - 210
KKKAPDTQSSASEKKRKRKRIRNRSNPKVLSEKQNAEGE                                   211 - 249
//

Text Mined References (13)

PMID Year Title