Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.02
PubTator Score 0.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ependymoma 2514 2.0517742221578E-10
medulloblastoma, large-cell 6234 1.13822877501922E-5
pediatric high grade glioma 2712 1.160734155572E-5
group 3 medulloblastoma 2254 1.24879569812746E-4
atypical teratoid / rhabdoid tumor 4369 2.32151040150896E-4
ovarian cancer 8492 4.03605941863396E-4
glioblastoma 5572 4.54779754572566E-4
primitive neuroectodermal tumor 3031 0.00167068103615212
osteosarcoma 7933 0.00604355048662162

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma 1.387 0.006
ependymoma 1.500 0.000
glioblastoma 1.500 0.000
group 3 medulloblastoma 1.600 0.000
atypical teratoid / rhabdoid tumor 1.400 0.000
medulloblastoma, large-cell 2.500 0.000
primitive neuroectodermal tumor 1.100 0.002
pediatric high grade glioma 1.500 0.000
ovarian cancer 1.100 0.000

Synonym

Accession Q9BRU9 B2RE25 Q96NJ8
Symbols C8orf53

Gene

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

AA Sequence

MKITRQKHAKKHLGFFRNNFGVREPYQILLDGTFCQAALRGRIQLREQLPRYLMGETQLCTTRCVLKELE      1 - 70
TLGKDLYGAKLIAQKCQVRNCPHFKNAVSGSECLLSMVEEGNPHHYFVATQDQNLSVKVKKKPGVPLMFI     71 - 140
IQNTMVLDKPSPKTIAFVKAVESGQLVSVHEKESIKHLKEEQGLVKNTEQSRRKKRKKISGPNPLSCLKK    141 - 210
KKKAPDTQSSASEKKRKRKRIRNRSNPKVLSEKQNAEGE                                   211 - 249
//

Text Mined References (10)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22180534 2012 Utp23p is required for dissociation of snR30 small nucleolar RNP from preribosomal particles.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
16769905 2006 The PINc domain protein Utp24, a putative nuclease, is required for the early cleavage steps in 18S rRNA maturation.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.