Property Summary

NCBI Gene PubMed Count 17
Grant Count 7
R01 Count 5
Funding $264,673.85
PubMed Score 25.60
PubTator Score 28.22

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
25692237 Data indicate that LA motif protein LARP6 binding to spliced leader RNA (5'SL) of collagen alpha2(I) mRNA is more stable than the binding to 5'SL of alpha1(I) mRNA.
25488812 The study presents the structure of the La motif and RRM1 of human LARP6 uncovering in both cases considerable structural variation in comparison to the equivalent domains in La and revealing an unprecedented fold for the RRM1.
25271881 We postulate that collagen mRNAs directly partition to the endoplasmic reticulum membrane prior to synthesis of the signal peptide and that LARP6 and nonmuscle myosin filaments mediate this process.
24469459 LARP6 is a critical mediator by which IGF-1 augments synthesis of collagen type I in vascular smooth muscle
23887937 The results demonstrate that the La modules of the human LARP6 is also active in tRNA-mediated suppression, even in the absence of stable UUU-3'OH trailer protection.
22139627 Acheron regulates vascular endothelial proliferation and angiogenesis together with Id1 during wound healing.
21387291 Achn enhances human breast tumor growth and vascularization and that this activity is dependent on nuclear localization.
19917293 LARP6 has a distinctive bipartite RNA binding domain not found in other members of the La superfamily. LARP6 interacts with the two single-stranded regions of the 5' stem-loop.
19889961 Acheron may influence differentiation in part via its control of cell adhesion dynamics.
17383118 These data define Achn as a newly discovered regulatory molecule that presumably mediates a variety of developmental and homeostatic processes in animals.

AA Sequence

MAQSGGEARPGPKTAVQIRVAIQEAEDVDELEDEEEGAETRGAGDPARYLSPGWGSASEEEPSRGHSGTT      1 - 70
ASGGENEREDLEQEWKPPDEELIKKLVDQIEFYFSDENLEKDAFLLKHVRRNKLGYVSVKLLTSFKKVKH     71 - 140
LTRDWRTTAHALKYSVVLELNEDHRKVRRTTPVPLFPNENLPSKMLLVYDLYLSPKLWALATPQKNGRVQ    141 - 210
EKVMEHLLKLFGTFGVISSVRILKPGRELPPDIRRISSRYSQVGTQECAIVEFEEVEAAIKAHEFMITES    211 - 280
QGKENMKAVLIGMKPPKKKPAKDKNHDEEPTASIHLNKSLNKRVEELQYMGDESSANSSSDPESNPTSPM    281 - 350
AGRRHAATNKLSPSGHQNLFLSPNASPCTSPWSSPLAQRKGVSRKSPLAEEGRLNCSTSPEIFRKCMDYS    351 - 420
SDSSVTPSGSPWVRRRRQAEMGTQEKSPGTSPLLSRKMQTADGLPVGVLRLPRGPDNTRGFHGHERSRAC    421 - 490
V//

Text Mined References (24)

PMID Year Title
25692237 2014 Characterization of binding of LARP6 to the 5' stem-loop of collagen mRNAs: implications for synthesis of type I collagen.
25488812 2015 Synergic interplay of the La motif, RRM1 and the interdomain linker of LARP6 in the recognition of collagen mRNA expands the RNA binding repertoire of the La module.
25271881 2014 Role of LARP6 and nonmuscle myosin in partitioning of collagen mRNAs to the ER membrane.
24469459 2014 Insulin-like growth factor-1 increases synthesis of collagen type I via induction of the mRNA-binding protein LARP6 expression and binding to the 5' stem-loop of COL1a1 and COL1a2 mRNA.
23887937 2013 Conservation of RNA chaperone activity of the human La-related proteins 4, 6 and 7.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22190748 2012 A novel role of RNA helicase A in regulation of translation of type I collagen mRNAs.
22139627 2011 Acheron regulates vascular endothelial proliferation and angiogenesis together with Id1 during wound healing.
21873549 2011 Genome-wide association identifies nine common variants associated with fasting proinsulin levels and provides new insights into the pathophysiology of type 2 diabetes.
21746880 2011 A novel role of vimentin filaments: binding and stabilization of collagen mRNAs.
More...