Property Summary

NCBI Gene PubMed Count 14
PubMed Score 54.34
PubTator Score 96.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma 1.100 5.5e-03
group 3 medulloblastoma 2.200 3.6e-04
interstitial cystitis 2.400 9.6e-04
intraductal papillary-mucinous neoplasm ... -1.100 2.7e-02
invasive ductal carcinoma 1.264 1.8e-03
non-small cell lung cancer -1.592 3.4e-16
osteosarcoma -2.915 2.5e-04
periodontitis 1.100 1.6e-28
primary Sjogren syndrome 1.600 7.6e-03
spina bifida 1.151 1.6e-02
ulcerative colitis 2.100 4.1e-05

Gene RIF (2)

AA Sequence

MLSSRWWPSSWGILGLGPRSPPRGSQLCALYAFTYTGADGQQVSLAEGDRFLLLRKTNSDWWLARRLEAP      1 - 70
STSRPIFVPAAYMIEESIPSQSPTTVIPGQLLWTPGPKLFHGSLEELSQALPSRAQASSEQPPPLPRKMC     71 - 140
RSVSTDNLSPSLLKPFQEGPSGRSLSQEDLPSEASASTAGPQPLMSEPPVYCNLVDLRRCPRSPPPGPAC    141 - 210
PLLQRLDAWEQHLDPNSGRCFYINSLTGCKSWKPPRRSRSETNPGSMEGTQTLKRNNDVLQPQAKGFRSD    211 - 280
TGTPEPLDPQGSLSLSQRTSQLDPPALQAPRPLPQLLDDPHEVEKSGLLNMTKIAQGGRKLRKNWGPSWV    281 - 350
VLTGNSLVFYREPPPTAPSSGWGPAGSRPESSVDLRGAALAHGRHLSSRRNVLHIRTIPGHEFLLQSDHE    351 - 420
TELRAWHRALRTVIERLVRWVEARREAPTGRDQGSGDRENPLELRLSGSGPAELSAGEDEEEESELVSKP    421 - 490
LLRLSSRRSSIRGPEGTEQNRVRNKLKRLIAKRPPLQSLQERGLLRDQVFGCQLESLCQREGDTVPSFLR    491 - 560
LCIAAVDKRGLDVDGIYRVSGNLAVVQKLRFLVDRERAVTSDGRYVFPEQPGQEGRLDLDSTEWDDIHVV    561 - 630
TGALKLFLRELPQPLVPPLLLPHFRAALALSESEQCLSQIQELIGSMPKPNHDTLRYLLEHLCRVIAHSD    631 - 700
KNRMTPHNLGIVFGPTLFRPEQETSDPAAHALYPGQLVQLMLTNFTSLFP                        701 - 750
//

Text Mined References (18)

PMID Year Title