Property Summary

NCBI Gene PubMed Count 14
Grant Count 13
Funding $1,288,529.45
PubMed Score 53.26
PubTator Score 96.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
osteosarcoma -3.988 0.000
periodontitis 1.100 0.000
non-small cell lung cancer -1.592 0.000
intraductal papillary-mucinous neoplasm ... -1.100 0.027
interstitial cystitis 2.400 0.001
adult high grade glioma 1.100 0.006
group 3 medulloblastoma 2.200 0.000
primary Sjogren syndrome 1.600 0.008
invasive ductal carcinoma 1.264 0.002
spina bifida 1.174 0.017
ulcerative colitis 2.100 0.000

Gene RIF (2)

PMID Text
19911011 The Ala370Ser polymorphism in the ARHGAP9 gene is associated with coronary artery spasm.
19911011 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLSSRWWPSSWGILGLGPRSPPRGSQLCALYAFTYTGADGQQVSLAEGDRFLLLRKTNSDWWLARRLEAP      1 - 70
STSRPIFVPAAYMIEESIPSQSPTTVIPGQLLWTPGPKLFHGSLEELSQALPSRAQASSEQPPPLPRKMC     71 - 140
RSVSTDNLSPSLLKPFQEGPSGRSLSQEDLPSEASASTAGPQPLMSEPPVYCNLVDLRRCPRSPPPGPAC    141 - 210
PLLQRLDAWEQHLDPNSGRCFYINSLTGCKSWKPPRRSRSETNPGSMEGTQTLKRNNDVLQPQAKGFRSD    211 - 280
TGTPEPLDPQGSLSLSQRTSQLDPPALQAPRPLPQLLDDPHEVEKSGLLNMTKIAQGGRKLRKNWGPSWV    281 - 350
VLTGNSLVFYREPPPTAPSSGWGPAGSRPESSVDLRGAALAHGRHLSSRRNVLHIRTIPGHEFLLQSDHE    351 - 420
TELRAWHRALRTVIERLVRWVEARREAPTGRDQGSGDRENPLELRLSGSGPAELSAGEDEEEESELVSKP    421 - 490
LLRLSSRRSSIRGPEGTEQNRVRNKLKRLIAKRPPLQSLQERGLLRDQVFGCQLESLCQREGDTVPSFLR    491 - 560
LCIAAVDKRGLDVDGIYRVSGNLAVVQKLRFLVDRERAVTSDGRYVFPEQPGQEGRLDLDSTEWDDIHVV    561 - 630
TGALKLFLRELPQPLVPPLLLPHFRAALALSESEQCLSQIQELIGSMPKPNHDTLRYLLEHLCRVIAHSD    631 - 700
KNRMTPHNLGIVFGPTLFRPEQETSDPAAHALYPGQLVQLMLTNFTSLFP                        701 - 750
//

Publication (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19911011 2010 Mutation of ARHGAP9 in patients with coronary spastic angina.
19807924 2009 Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17339315 2007 Non-canonical interaction of phosphoinositides with pleckstrin homology domains of Tiam1 and ArhGAP9.
17284314 2007 ArhGAP9, a novel MAP kinase docking protein, inhibits Erk and p38 activation through WW domain binding.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...