Property Summary

NCBI Gene PubMed Count 29
Grant Count 2
R01 Count 2
Funding $336,600
PubMed Score 25.32
PubTator Score 28.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.738 0.000

Synonym

Accession Q9BRQ0 Q8WYZ4 Q96CY2
Symbols 1190004M21Rik

Gene

 Grant Application (2)

PDB

2XB1   4UP0   4UP5  

 GO Component (1)

Gene RIF (17)

PMID Text
26345837 this study demonstrated that SNPs in the coding region of Pygo2 might be one of the causative factors in idiopathic oligospermia and azoospermia, resulting in male infertility.
26170450 Pygo2 is a common node downstream of oncogenic Wnt and Akt signaling pathways.
25871475 Pygopus-2 over-expression is associated with hepatic carcinoma.
25545771 Our findings suggest that Pygopus-2 may be an important predictor of poor outcome in HCC patients, and could serve as a novel biomarker for HCC.
23865714 We conclude that abnormal Pygo2 protein expression may be a marker for advanced non-small cell lung cancer
23732668 SNPs in the coding region of Pygo2 gene may be one of the causative factors in idiopathic oligospermia and azoospermia, resulting in male infertility.
23517060 The results of the present study suggest a novel involvement of Pygo in the promotion of rRNA transcription in cancer cells
23456637 PYGO2 is identified as a new molecular marker of invasive tumors in esophageal squamous cell carcinoma.
22186018 Pygo2 directly occupies the promoters of multiple histone genes and enhances the acetylation of lysine 56 in histone H3.
20937768 Data show that Pygo2 associates with MLL2 histone methyltransferase and STAGA histone acetyltransferase to facilitate their interaction with beta-catenin and Wnt1-induced, TCF/LEF-dependent transactivation in breast cancer cells.
More...

AA Sequence

MAASAPPPPDKLEGGGGPAPPPAPPSTGRKQGKAGLQMKSPEKKRRKSNTQGPAYSHLTEFAPPPTPMVD      1 - 70
HLVASNPFEDDFGAPKVGVAAPPFLGSPVPFGGFRVQGGMAGQVPPGYSTGGGGGPQPLRRQPPPFPPNP     71 - 140
MGPAFNMPPQGPGYPPPGNMNFPSQPFNQPLGQNFSPPSGQMMPGPVGGFGPMISPTMGQPPRAELGPPS    141 - 210
LSQRFAQPGAPFGPSPLQRPGQGLPSLPPNTSPFPGPDPGFPGPGGEDGGKPLNPPASTAFPQEPHSGSP    211 - 280
AAAVNGNQPSFPPNSSGRGGGTPDANSLAPPGKAGGGSGPQPPPGLVYPCGACRSEVNDDQDAILCEASC    281 - 350
QKWFHRECTGMTESAYGLLTTEASAVWACDLCLKTKEIQSVYIREGMGQLVAANDG                  351 - 406
//

Text Mined References (35)

PMID Year Title
26345837 2015 Associations of single nucleotide polymorphisms in the Pygo2 coding sequence with idiopathic oligospermia and azoospermia.
26170450 2015 Akt Phosphorylates Wnt Coactivator and Chromatin Effector Pygo2 at Serine 48 to Antagonize Its Ubiquitin/Proteasome-mediated Degradation.
25871475 2015 Pygopus-2 promotes invasion and metastasis of hepatic carcinoma cell by decreasing E-cadherin expression.
25545771 2015 Abnormal nuclear expression of Pygopus-2 in human primary hepatocellular carcinoma correlates with a poor prognosis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23865714 2013 Abnormal expression of Pygopus 2 correlates with a malignant phenotype in human lung cancer.
23732668 2013 [Association of single nucleotide polymorphisms(SNPs) in Pygo2 coding gene with idiopathic oligospermia and azoospermia].
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23517060 2013 Evidence of a novel role for Pygopus in rRNA transcription.
23456637 2013 Association of PYGO2 and EGFR in esophageal squamous cell carcinoma.
More...