Property Summary

NCBI Gene PubMed Count 18
PubMed Score 41.84
PubTator Score 22.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma 2.100 0.002
ependymoma 2.000 0.001
oligodendroglioma 2.100 0.000
osteosarcoma 1.155 0.000
glioblastoma -1.100 0.002
intraductal papillary-mucinous neoplasm ... -1.200 0.009
lung cancer 1.400 0.001
acute myeloid leukemia -1.200 0.009

Gene RIF (2)

PMID Text
22316138 These results show that intracellular levels of Spt6 are fine-tuned by PAAF1 and proteasome, which is required for HIV-1 transcription and extends to cellular genes implicated in cancer.
15831487 Proteasomal ATPase-associated factor 1 (PAAF1) functions as a negative regulator of the proteasome by controlling the assembly/disassembly of the proteasome.

AA Sequence

MAAPLRIQSDWAQALRKDEGEAWLSCHPPGKPSLYGSLTCQGIGLDGIPEVTASEGFTVNEINKKSIHIS      1 - 70
CPKENASSKFLAPYTTFSRIHTKSITCLDISSRGGLGVSSSTDGTMKIWQASNGELRRVLEGHVFDVNCC     71 - 140
RFFPSGLVVLSGGMDAQLKIWSAEDASCVVTFKGHKGGILDTAIVDRGRNVVSASRDGTARLWDCGRSAC    141 - 210
LGVLADCGSSINGVAVGAADNSINLGSPEQMPSEREVGTEAKMLLLAREDKKLQCLGLQSRQLVFLFIGS    211 - 280
DAFNCCTFLSGFLLLAGTQDGNIYQLDVRSPRAPVQVIHRSGAPVLSLLSVRDGFIASQGDGSCFIVQQD    281 - 350
LDYVTELTGADCDPVYKVATWEKQIYTCCRDGLVRRYQLSDL                                351 - 392
//

Text Mined References (21)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
22691779 2012 New crystal structure of the proteasome-dedicated chaperone Rpn14 at 1.6?Å resolution.
22316138 2012 Spt6 levels are modulated by PAAF1 and proteasome to regulate the HIV-1 LTR.
22275368 2012 Stable incorporation of ATPase subunits into 19 S regulatory particle of human proteasome requires nucleotide binding and C-terminal tails.
22194858 2011 Reduction in inflammatory gene expression in skeletal muscle from Roux-en-Y gastric bypass patients randomized to omentectomy.
21269460 2011 Initial characterization of the human central proteome.
20471945 2010 Heterohexameric ring arrangement of the eukaryotic proteasomal ATPases: implications for proteasome structure and assembly.
19490896 2009 Assembly pathway of the Mammalian proteasome base subcomplex is mediated by multiple specific chaperones.
19446322 2009 Multiple assembly chaperones govern biogenesis of the proteasome regulatory particle base.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...