Property Summary

NCBI Gene PubMed Count 19
PubMed Score 17.43
PubTator Score 6.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

 GO Component (1)

Gene RIF (11)

AA Sequence

MPKVFLVKRRSLGVSVRSWDELPDEKRADTYIPVGLGRLLHDPPEDCRSDGGSSSGSGSSSAGEPGGAES      1 - 70
SSSPHAPESETPEPGDAEGPDGHLATKQRPVARSKIKFTTGTCSDSVVHSCDLCGKGFRLQRMLNRHLKC     71 - 140
HNQVKRHLCTFCGKGFNDTFDLKRHVRTHTGIRPYKCNVCNKAFTQRCSLESHLKKIHGVQQQYAYKQRR    141 - 210
DKLYVCEDCGYTGPTQEDLYLHVNSAHPGSSFLKKTSKKLAALLQGKLTSAHQENTSLSEEEERK         211 - 275
//

Text Mined References (20)

PMID Year Title