Property Summary

NCBI Gene PubMed Count 8
Grant Count 11
R01 Count 10
Funding $811,505.49
PubMed Score 25.34
PubTator Score 25.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma -1.300 0.013
ependymoma -1.500 0.035
osteosarcoma 1.959 0.000
atypical teratoid / rhabdoid tumor -1.300 0.000
glioblastoma -1.500 0.000
medulloblastoma -1.300 0.002
medulloblastoma, large-cell -1.800 0.000
primitive neuroectodermal tumor -1.300 0.006
active ulcerative colitis -1.095 0.007
breast carcinoma -1.200 0.007
fibroadenoma -1.200 0.039
adult high grade glioma -1.200 0.013
subependymal giant cell astrocytoma -1.335 0.013
lung adenocarcinoma 2.000 0.000
ductal carcinoma in situ -2.300 0.001
ovarian cancer 1.600 0.000
pituitary cancer 1.100 0.000
facioscapulohumeral dystrophy 1.300 0.016

 GO Component (1)

Gene RIF (4)

PMID Text
25187301 The MESP1-NKX2-5 hESC reporter line allows us to identify molecular cues crucial for specification and expansion of human cardiac mesoderm and early progenitors and their differentiation to specific cardiovascular derivatives.
24056064 MESP1 SNPs are associated with congenital heart disease in patients and altered transcription in vitro.
22826236 Transcription factors ETS2 and MESP1 transdifferentiate human dermal fibroblasts into cardiac progenitors.
18297060 MesP1 drives vertebrate cardiovascular differentiation through Dkk-1-mediated blockade of Wnt-signalling

AA Sequence

MAQPLCPPLSESWMLSAAWGPTRRPPPSDKDCGRSLVSSPDSWGSTPADSPVASPARPGTLRDPRAPSVG      1 - 70
RRGARSSRLGSGQRQSASEREKLRMRTLARALHELRRFLPPSVAPAGQSLTKIETLRLAIRYIGHLSAVL     71 - 140
GLSEESLQRRCRQRGDAGSPRGCPLCPDDCPAQMQTRTQAEGQGQGRGLGLVSAVRAGASWGSPPACPGA    141 - 210
RAAPEPRDPPALFAEAACPEGQAMEPSPPSPLLPGDVLALLETWMPLSPLEWLPEEPK                211 - 268
//

Text Mined References (10)

PMID Year Title
25187301 2015 Dual reporter MESP1 mCherry/w-NKX2-5 eGFP/w hESCs enable studying early human cardiac differentiation.
24056064 2013 Mutational analysis of the human MESP1 gene in patients with congenital heart disease reveals a highly variable sequence in exon 1.
22826236 2012 Transcription factors ETS2 and MESP1 transdifferentiate human dermal fibroblasts into cardiac progenitors.
18297060 2008 MesP1 drives vertebrate cardiovascular differentiation through Dkk-1-mediated blockade of Wnt-signalling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15122512 2004 Mutated MESP2 causes spondylocostal dysostosis in humans.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11578861 2001 Transcriptional regulation of Mesp1 and Mesp2 genes: differential usage of enhancers during development.
8787751 1996 MesP1: a novel basic helix-loop-helix protein expressed in the nascent mesodermal cells during mouse gastrulation.