Property Summary

NCBI Gene PubMed Count 25
PubMed Score 39.41
PubTator Score 25.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Endometriosis -1.003 4.3e-02
intraductal papillary-mucinous adenoma (... -2.700 1.8e-04
intraductal papillary-mucinous carcinoma... -2.400 6.2e-04
intraductal papillary-mucinous neoplasm ... -2.700 3.9e-03
osteosarcoma 1.244 1.0e-05
ovarian cancer 1.400 6.0e-11
pancreatic cancer -1.400 2.5e-04
primary pancreatic ductal adenocarcinoma -1.062 5.4e-03
psoriasis -1.300 1.2e-19

Gene RIF (14)

AA Sequence

MEAKEKQHLLDARPAIRSYTGSLWQEGAGWIPLPRPGLDLQAIELAAQSNHHCHAQKGPDSHCDPKKGKA      1 - 70
QRQLYVASAICLLFMIGEVVEILGALVSVLSIWVVTGVLVYLAVERLISGDYEIDGGTMLITSGCAVAVN     71 - 140
IIMGLTLHQSGHGHSHGTTNQQEENPSVRAAFIHVIGDFMQSMGVLVAAYILYFKPEYKYVDPICTFVFS    141 - 210
ILVLGTTLTILRDVILVLMEGTPKGVDFTAVRDLLLSVEGVEALHSLHIWALTVAQPVLSVHIAIAQNTD    211 - 280
AQAVLKTASSRLQGKFHFHTVTIQIEDYSEDMKDCQACQGPSD                               281 - 323
//

Text Mined References (28)

PMID Year Title