Property Summary

NCBI Gene PubMed Count 32
PubMed Score 10.74
PubTator Score 5.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
group 3 medulloblastoma 1.700 0.000

Synonym

Accession Q9BRD0 A8K0S0 Q96LS7
Symbols Cwc26
fSAP71

Gene

Gene RIF (8)

PMID Text
26634697 When the inter-dependence between alleles was examined using conditional models, five loci on BUD13, ZNF259, and ApoA5 showed possible independent associations.
26397108 Single nucleotide polymorphisms (Rs17119975) of BUD13 protein did not increase the risk of CHD in the Chinese population.
25900265 Common SNPs within the BUD13-APOA5 gene region can effect triglyceride and LDL cholesterol response to statin therapy.
24989072 Significant linkage disequilibria were noted among ZNF259, BUD13 and MLXIPL SNPs and serum lipid levels.
24780069 Single nucleotide polymorphism bud13 gene is associated with hyperlipidaemia.
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20442857 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19656773 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAAPPLSKAEYLKRYLSGADAGVDRGSESGRKRRKKRPKPGGAGGKGMRIVDDDVSWTAISTTKLEKEE      1 - 70
EEDDGDLPVVAEFVDERPEEVKQMEAFRSSAKWKLLGGHNEDLPSNRHFRHDTPDSSPRRVRHGTPDPSP     71 - 140
RKDRHDTPDPSPRRARHDTPDPSPLRGARHDSDTSPPRRIRHDSSDTSPPRRARHDSPDPSPPRRPQHNS    141 - 210
SGASPRRVRHDSPDPSPPRRARHGSSDISSPRRVHNNSPDTSRRTLGSSDTQQLRRARHDSPDLAPNVTY    211 - 280
SLPRTKSGKAPERASSKTSPHWKESGASHLSFPKNSKYEYDPDISPPRKKQAKSHFGDKKQLDSKGDCQK    281 - 350
ATDSDLSSPRHKQSPGHQDSDSDLSPPRNRPRHRSSDSDLSPPRRRQRTKSSDSDLSPPRRSQPPGKKAA    351 - 420
HMYSGAKTGLVLTDIQREQQELKEQDQETMAFEAEFQYAETVFRDKSGRKRNLKLERLEQRRKAEKDSER    421 - 490
DELYAQWGKGLAQSRQQQQNVEDAMKEMQKPLARYIDDEDLDRMLREQEREGDPMANFIKKNKAKENKNK    491 - 560
KVRPRYSGPAPPPNRFNIWPGYRWDGVDRSNGFEQKRFARLASKKAVEELAYKWSVEDM               561 - 619
//

Text Mined References (45)

PMID Year Title
26634697 2016 Multiple susceptibility loci at chromosome 11q23.3 are associated with plasma triglyceride in East Asians.
26397108 2015 Effects of Polymorphisms in APOA4-APOA5-ZNF259-BUD13 Gene Cluster on Plasma Levels of Triglycerides and Risk of Coronary Heart Disease in a Chinese Han Population.
25900265 2015 Differential Lipid Response to Statins Is Associated With Variants in the BUD13-APOA5 Gene Region.
25416956 2014 A proteome-scale map of the human interactome network.
25240745 2014 A genome-wide association study in the genetic analysis of idiopathic thrombophilia project suggests sex-specific regulation of mitochondrial DNA levels.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24989072 2014 Association between the MLX interacting protein-like, BUD13 homolog and zinc finger protein 259 gene polymorphisms and serum lipid levels.
24886709 2014 Amerindian-specific regions under positive selection harbour new lipid variants in Latinos.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24780069 2014 Association of the variants in the BUD13-ZNF259 genes and the risk of hyperlipidaemia.
More...