Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.88
PubTator Score 1.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

Synonym

Accession Q9BR11 Q5JZH2 Q9BR12 Q9BV30
Symbols C20orf162

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

 GO Function (1)

 GO Component (1)

Gene RIF (1)

AA Sequence

MLERLKAPWSAALQRKYFDLGIWTAPISPMALTMLNGLLIKDSSPPMLLHQVNKTAQLDTFNYQSCFMQS      1 - 70
VFDHFPEILFIHRTYNPRGKVLYTFLVDGPRVQLEGHLARAVYFAIPAKEDTEGLAQMFQVFKKFNPAWE     71 - 140
RVCTILVDPHFLPLPILAMEFPTAEVLLSAFHICKFLQAKFYQLSLERPVERLLLTSLQSTMCSATAGNL    141 - 210
RKLYTLLSNCIPPAKLPELHSHWLLNDRIWLAHRWRSRAESSHYFQSLEVTTHILSQFFGTTPSEKQGMA    211 - 280
SLFRYMQQNSADKANFNQGLCAQNNHAPSDTIPESPKLEQLVESHIQHSLNAICTGPAAQLCLGELAVVQ    281 - 350
KSTHLIGSGSEKMNIQILEDTHKVQPQPPASCSCYFNQAFHLPCRHILAMLSARRQVLQPDMLPAQWTAG    351 - 420
CATSLDSILGSKWSETLDKHLAVTHLTEEVGQLLQHCTKEEFERRYSTLRELADSWIGPYEQVQL         421 - 485
//

Text Mined References (4)

PMID Year Title