Property Summary

NCBI Gene PubMed Count 9
Grant Count 5
R01 Count 5
Funding $194,055.51
PubMed Score 3.16
PubTator Score 2.45

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
19472918 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAASEPVDSGALWGLERPEPPPTRFHRVHGANIRVDPSGTRATRVESFAHGVCFSREPLAPGQVFLVEI      1 - 70
EEKELGWCGHLRLGLTALDPASLAPVPEFSLPDLVNLGHTWVFAITRHHNRVPREGRPEAEAAAPSRPPT     71 - 140
LLVEPYLRIEQFRIPRDRLVGRSRPGLYSHLLDQLYELNVLPPTARRSRLGVLFCPRPDGTADMHIIING    141 - 210
EDMGPSARGLPAAQPLYAVVDVFASTKSVRLVQLEYGLPSLQTLCRLVIQRSMVHRLAIDGLHLPKELKD    211 - 280
FCKYE                                                                     281 - 285
//

Text Mined References (9)

PMID Year Title
19723503 2009 Neuralized-2: expression in human and rodents and interaction with Delta-like ligands.
19472918 2008 Candidate-gene testing for orphan limb-girdle muscular dystrophies.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14992713 2004 Ozz; a new name on the long list of beta-catenin's nemeses.
14960280 2004 Ozz-E3, a muscle-specific ubiquitin ligase, regulates beta-catenin degradation during myogenesis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12076535 2002 The SOCS box: a tale of destruction and degradation.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.