Property Summary

NCBI Gene PubMed Count 16
Grant Count 2
R01 Count 2
Funding $801,900
PubMed Score 8.19
PubTator Score 7.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -2.000 0.000
osteosarcoma 2.064 0.000
glioblastoma 1.300 0.001
acute quadriplegic myopathy -1.208 0.000
tuberculosis and treatment for 6 months -1.400 0.000
colon cancer -1.100 0.035
lung cancer -1.600 0.000
pediatric high grade glioma 1.200 0.001
pilocytic astrocytoma 1.200 0.000
subependymal giant cell astrocytoma 2.608 0.007
invasive ductal carcinoma -1.200 0.005
ovarian cancer -2.600 0.000
Breast cancer -1.100 0.000

Synonym

Accession Q9BQS8 B7ZKT7 Q3MJE6 Q86T41 Q86TB1 Q8TEF9 Q96IV5 Q9H8P9
Symbols CATC2
RUFY3
ZFYVE7
CTRCT18

Gene

 Grant Application (2)

PDB

5CX3   5D94  

Gene RIF (6)

PMID Text
26468287 FYCO1 requires a functional LC3A/B-preferring LC3-interacting Region (LIR) motif to facilitate efficient maturation of autophagosomes under basal conditions, whereas starvation-induced autophagy was unaffected
21636066 FYCO1 is involved in lens development and transparency in humans, and mutations in this gene are one of the most common causes of autosomal-recessive congenital cataracts in the Pakistani population.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20100911 We have characterized the LC3-, Rab7-, and phosphatidylinositol-3-phosphate-binding domains in FYCO1 and mapped part of the CC region essential for MT plus end-directed transport.
11896456 Maps to a region of chromosome 3p21.3 which is frequently deleted in tumors.

AA Sequence

MASTNAESQLQRIIRDLQDAVTELSKEFQEAGEPITDDSTSLHKFSYKLEYLLQFDQKEKATLLGNKKDY      1 - 70
WDYFCACLAKVKGANDGIRFVKSISELRTSLGKGRAFIRYSLVHQRLADTLQQCFMNTKVTSDWYYARSP     71 - 140
FLQPKLSSDIVGQLYELTEVQFDLASRGFDLDAAWPTFARRTLTTGSSAYLWKPPSRSSSMSSLVSSYLQ    141 - 210
TQEMVSNFDLNSPLNNEALEGFDEMRLELDQLEVREKQLRERMQQLDRENQELRAAVSQQGEQLQTERER    211 - 280
GRTAAEDNVRLTCLVAELQKQWEVTQATQNTVKELQTCLQGLELGAAEKEEDYHTALRRLESMLQPLAQE    281 - 350
LEATRDSLDKKNQHLASFPGWLAMAQQKADTASDTKGRQEPIPSDAAQEMQELGEKLQALERERTKVEEV    351 - 420
NRQQSAQLEQLVKELQLKEDARASLERLVKEMAPLQEELSGKGQEADQLWRRLQELLAHTSSWEEELAEL    421 - 490
RREKKQQQEEKELLEQEVRSLTRQLQFLETQLAQVSQHVSDLEEQKKQLIQDKDHLSQQVGMLERLAGPP    491 - 560
GPELPVAGEKNEALVPVNSSLQEAWGKPEEEQRGLQEAQLDDTKVQEGSQEEELRQANRELEKELQNVVG    561 - 630
RNQLLEGKLQALQADYQALQQRESAIQGSLASLEAEQASIRHLGDQMEASLLAVRKAKEAMKAQMAEKEA    631 - 700
ILQSKEGECQQLREEVEQCQQLAEARHRELRALESQCQQQTQLIEVLTAEKGQQGVGPPTDNEARELAAQ    701 - 770
LALSQAQLEVHQGEVQRLQAQVVDLQAKMRAALDDQDKVQSQLSMAEAVLREHKTLVQQLKEQNEALNRA    771 - 840
HVQELLQCSEREGALQEERADEAQQREEELRALQEELSQAKCSSEEAQLEHAELQEQLHRANTDTAELGI    841 - 910
QVCALTVEKERVEEALACAVQELQDAKEAASREREGLERQVAGLQQEKESLQEKLKAAKAAAGSLPGLQA    911 - 980
QLAQAEQRAQSLQEAAHQELNTLKFQLSAEIMDYQSRLKNAGEECKSLRGQLEEQGRQLQAAEEAVEKLK    981 - 1050
ATQADMGEKLSCTSNHLAECQAAMLRKDKEGAALREDLERTQKELEKATTKIQEYYNKLCQEVTNRERND   1051 - 1120
QKMLADLDDLNRTKKYLEERLIELLRDKDALWQKSDALEFQQKLSAEERWLGDTEANHCLDCKREFSWMV   1121 - 1190
RRHHCRICGRIFCYYCCNNYVLSKHGGKKERCCRACFQKLSEGPGSPDSSGSGTSQGEPSPALSPASPGP   1191 - 1260
QATGGQGANTDYRPPDDAVFDIITDEELCQIQESGSSLPETPTETDSLDPNAAEQDTTSTSLTPEDTEDM   1261 - 1330
PVGQDSEICLLKSGELMIKVPLTVDEIASFGEGSRELFVRSSTYSLIPITVAEAGLTISWVFSSDPKSIS   1331 - 1400
FSVVFQEAEDTPLDQCKVLIPTTRCNSHKENIQGQLKVRTPGIYMLIFDNTFSRFVSKKVFYHLTVDRPV   1401 - 1470
IYDGSDFL                                                                 1471 - 1478
//

Text Mined References (25)

PMID Year Title
26468287 2015 FYCO1 Contains a C-terminally Extended, LC3A/B-preferring LC3-interacting Region (LIR) Motif Required for Efficient Maturation of Autophagosomes during Basal Autophagy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24089205 2013 Autophagy promotes primary ciliogenesis by removing OFD1 from centriolar satellites.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21636066 2011 Mutations in FYCO1 cause autosomal-recessive congenital cataracts.
21269460 2011 Initial characterization of the human central proteome.
20562859 2010 Network organization of the human autophagy system.
More...