Property Summary

NCBI Gene PubMed Count 3
PubMed Score 3.43

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BQM9 Q1AHR2
Symbols dJ63M2.6

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (0)

AA Sequence

MGNYSSHKRTKAPKQARKERPADMDKAWWKSFLNHLTRKKPATRIVLILPLDKRQPLANAGQRIDYASGA      1 - 70
GLGSPAAPRLRGAGEGSEREPRMPVLLLLRRQEARRPEEGGARAALSWPRLLSRFRSPGKAPREAGPAEE     71 - 140
QPRKRCRCPRPQL                                                             141 - 153
//

Text Mined References (3)

PMID Year Title