Property Summary

NCBI Gene PubMed Count 3
PubMed Score 3.43

Knowledge Summary

Patent

No data available

Synonym

Accession Q9BQM9 Q1AHR2
Symbols dJ63M2.6

Gene

 Compartment GO Term (0)

AA Sequence

MGNYSSHKRTKAPKQARKERPADMDKAWWKSFLNHLTRKKPATRIVLILPLDKRQPLANAGQRIDYASGA      1 - 70
GLGSPAAPRLRGAGEGSEREPRMPVLLLLRRQEARRPEEGGARAALSWPRLLSRFRSPGKAPREAGPAEE     71 - 140
QPRKRCRCPRPQL                                                             141 - 153
//

Text Mined References (3)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.