Property Summary

NCBI Gene PubMed Count 3
PubMed Score 3.43

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MGNYSSHKRTKAPKQARKERPADMDKAWWKSFLNHLTRKKPATRIVLILPLDKRQPLANAGQRIDYASGA      1 - 70
GLGSPAAPRLRGAGEGSEREPRMPVLLLLRRQEARRPEEGGARAALSWPRLLSRFRSPGKAPREAGPAEE     71 - 140
QPRKRCRCPRPQL                                                             141 - 153
//

Text Mined References (3)

PMID Year Title