Property Summary

NCBI Gene PubMed Count 64
PubMed Score 867.59
PubTator Score 75.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.100 3.6e-02
ovarian cancer -1.300 5.8e-03

Gene RIF (44)

AA Sequence

MERQEESLSARPALETEGLRFLHTTVGSLLATYGWYIVFSCILLYVVFQKLSARLRALRQRQLDRAAAAV      1 - 70
EPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDS     71 - 140
PGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGRRGPSSGGUG                         141 - 189
//

Text Mined References (72)

PMID Year Title