Property Summary

NCBI Gene PubMed Count 61
Grant Count 245
R01 Count 144
Funding $26,286,520.25
PubMed Score 800.65
PubTator Score 75.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.100 0.036
ovarian cancer 2.300 0.000

Synonym

Accession Q9BQE4 Q3B771 Q9P0I6 SelS
Symbols SELS
VIMP
ADO15
SBBI8
SEPS1
AD-015

Gene

PDB

2Q2F  

Gene RIF (41)

PMID Text
26504085 interaction between SelK and p97(VCP) is SelS-dependent, and the resulting ERAD complex (SelS-p97(VCP)-SelK) plays an important role in ERAD and ER stress
26016409 Potential roles of the SEPS1 gene in the pathogenesis and etiology of Hashimoto's thyroiditis.
25433273 The SEPS1 -105G>A is associated with an increased risk of Kashin-Beck disease and influences the expression of PI3K/Akt signaling pathway in Kashin-Beck disease patients
25390504 SNP rs4965814 of SELS may affect the susceptibility to ischemic stroke.
25008318 Although VIMP can interact with CLIMP-63 and Syn5L, it does not interact with MT-binding ER proteins (such as Reep1) that shape the tubular smooth ER
24700463 Pro(178) and Pro(183) of SelS play important roles in the translocation of p97(VCP) to the ER membrane and protect cells from ER stress
24573439 that SEPS1 may protect mice against LPS-induced sepsis and organ damage. Therefore, SEPS1 may be a new target to resolve LPS-induced sepsis.
24471570 Existence of a link between SEPS1 promoter genetic variation and Hashimoto thyroiditis risk.
24275540 Selenoprotein S is a marker but not a regulator of endoplasmic reticulum stress in intestinal epithelial cells in inflammatory bowel diseases.
23914919 Data suggest that selenocysteine allows selenoprotein S (SelS, VIMP) to sustain activity under oxidative stress.
More...

AA Sequence

MERQEESLSARPALETEGLRFLHTTVGSLLATYGWYIVFSCILLYVVFQKLSARLRALRQRQLDRAAAAV      1 - 70
EPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDS     71 - 140
PGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGRRGPSSGGUG                         141 - 189
//

Text Mined References (68)

PMID Year Title
26504085 2015 Selenoprotein S-dependent Selenoprotein K Binding to p97(VCP) Protein Is Essential for Endoplasmic Reticulum-associated Degradation.
26016409 2015 Association studies of SEPS1 gene polymorphisms with Hashimoto's thyroiditis in Han Chinese.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25433273 2015 Role of selenoprotein S (SEPS1) -105G>A polymorphisms and PI3K/Akt signaling pathway in Kashin-Beck disease.
25390504 2015 Association of selenoprotein S gene polymorphism with ischemic stroke in a Chinese case-control study.
25008318 2014 Valosin-containing protein-interacting membrane protein (VIMP) links the endoplasmic reticulum with microtubules in concert with cytoskeleton-linking membrane protein (CLIMP)-63.
24700463 2014 Pro178 and Pro183 of selenoprotein S are essential residues for interaction with p97(VCP) during endoplasmic reticulum-associated degradation.
24573439 2014 Protective effects of the SEPS1 gene on lipopolysaccharide-induced sepsis.
24471570 2014 A polymorphism in the promoter region of the selenoprotein S gene (SEPS1) contributes to Hashimoto's thyroiditis susceptibility.
24424410 2014 USP13 antagonizes gp78 to maintain functionality of a chaperone in ER-associated degradation.
More...