Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Gene RIF (1)

AA Sequence

MFLTALLWRGRIPGRQWIGKHRRPRFVSLRAKQNMIRRLEIEAENHYWLSMPYMTREQERGHAAVRRREA      1 - 70
FEAIKAAATSKFPPHRFIADQLDHLNVTKKWS                                           71 - 102
//

Text Mined References (13)

PMID Year Title