Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Synonym

Accession Q9BQC6 A2A332 hMRP63
Symbols MRP63
bMRP63

Gene

PDB

3J9M   3J7Y   5OOL   5OOM  

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

Gene RIF (1)

AA Sequence

MFLTALLWRGRIPGRQWIGKHRRPRFVSLRAKQNMIRRLEIEAENHYWLSMPYMTREQERGHAAVRRREA      1 - 70
FEAIKAAATSKFPPHRFIADQLDHLNVTKKWS                                           71 - 102
//

Text Mined References (13)

PMID Year Title