Property Summary

NCBI Gene PubMed Count 20
Grant Count 13
R01 Count 13
Funding $817,805.04
PubMed Score 10.69
PubTator Score 14.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
osteosarcoma -1.102 0.000
tuberculosis and treatment for 6 months -1.200 0.000
lung cancer 1.800 0.000

Gene RIF (12)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19170105 Results suggest that cyclin-dependent kinase inhibitors selectively control stimulation of the histone H4 gene promoter by the p220(NPAT)/HiNF-P complex.
18850719 a novel HiNF-P-specific conserved region represents a DNA-binding determinant that plays a role in mediating histone gene expression during the cell cycle and defines HiNF-P as a cell cycle regulatory member of the zinc finger transcription factor family
17974976 HiNF-P/P220NPAT regulates expression of nonhistone targets that influence competency for cell cycle progression.
17176114 HiNF-P-dependent stabilization of p220NPAT reinforces signaling through the cyclin E/CDK2/p220NPAT pathway and contributes to coordinate control of histone gene expression.
17163457 HiNF-P is a bifunctional regulator of cell cycle controlled histone H4 gene transcription.
17049487 These results suggest that RFP is a mediator connecting several MBD proteins and allowing the formation of a more potent transcriptional repressor complex.
16786000 the transcriptional silencing of the 14-3-3sigma gene is caused by promoter CpG island methylation associated with MBD2, which may play an important role in prostate cancer progression during the invasive and metastatic stages of the disease
15988025 HiNF-P interacts directly with p220(NPAT) to coactivate histone genes during S phase.
More...

AA Sequence

MPPPGKVPRKENLWLQCEWGSCSFVCSTMEKFFEHVTQHLQQHLHGSGEEEEEEEEDDPLEEEFSCLWQE      1 - 70
CGFCSLDSSADLIRHVYFHCYHTKLKQWGLQALQSQADLGPCILDFQSRNVIPDIPDHFLCLWEHCENSF     71 - 140
DNPEWFYRHVEAHSLCCEYEAVGKDNPVVLCGWKGCTCTFKDRSKLREHLRSHTQEKVVACPTCGGMFAN    141 - 210
NTKFLDHIRRQTSLDQQHFQCSHCSKRFATERLLRDHMRNHVNHYKCPLCDMTCPLPSSLRNHMRFRHSE    211 - 280
DRPFKCDCCDYSCKNLIDLQKHLDTHSEEPAYRCDFENCTFSARSLCSIKSHYRKVHEGDSEPRYKCHVC    281 - 350
DKCFTRGNNLTVHLRKKHQFKWPSGHPRFRYKEHEDGYMRLQLVRYESVELTQQLLRQPQEGSGLGTSLN    351 - 420
ESSLQGIILETVPGEPGRKEEEEEGKGSEGTALSASQDNPSSVIHVVNQTNAQGQQEIVYYVLSEAPGEP    421 - 490
PPAPEPPSGGIMEKLQGIAEEPEIQMV                                               491 - 517
//

Text Mined References (22)

PMID Year Title
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19170105 2009 CDK inhibitors selectively diminish cell cycle controlled activation of the histone H4 gene promoter by p220NPAT and HiNF-P.
18850719 2008 The histone gene cell cycle regulator HiNF-P is a unique zinc finger transcription factor with a novel conserved auxiliary DNA-binding motif.
17974976 2007 The HiNF-P/p220NPAT cell cycle signaling pathway controls nonhistone target genes.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17577209 2007 The interactome of the histone gene regulatory factor HiNF-P suggests novel cell cycle related roles in transcriptional control and RNA processing.
17176114 2006 The histone gene transcription factor HiNF-P stabilizes its cell cycle regulatory co-activator p220NPAT.
17163457 2007 HiNF-P is a bifunctional regulator of cell cycle controlled histone H4 gene transcription.
17049487 2006 RET finger protein enhances MBD2- and MBD4-dependent transcriptional repression.
More...