Property Summary

NCBI Gene PubMed Count 20
PubMed Score 10.54
PubTator Score 14.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
malignant mesothelioma 3232 5.8e-06
lung cancer 4740 4.2e-05
tuberculosis and treatment for 6 months 409 1.0e-04
osteosarcoma 7950 1.6e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 1.800 4.2e-05
malignant mesothelioma 1.100 5.8e-06
osteosarcoma -1.102 1.6e-04
tuberculosis and treatment for 6 months -1.200 1.0e-04

Gene RIF (12)

AA Sequence

MPPPGKVPRKENLWLQCEWGSCSFVCSTMEKFFEHVTQHLQQHLHGSGEEEEEEEEDDPLEEEFSCLWQE      1 - 70
CGFCSLDSSADLIRHVYFHCYHTKLKQWGLQALQSQADLGPCILDFQSRNVIPDIPDHFLCLWEHCENSF     71 - 140
DNPEWFYRHVEAHSLCCEYEAVGKDNPVVLCGWKGCTCTFKDRSKLREHLRSHTQEKVVACPTCGGMFAN    141 - 210
NTKFLDHIRRQTSLDQQHFQCSHCSKRFATERLLRDHMRNHVNHYKCPLCDMTCPLPSSLRNHMRFRHSE    211 - 280
DRPFKCDCCDYSCKNLIDLQKHLDTHSEEPAYRCDFENCTFSARSLCSIKSHYRKVHEGDSEPRYKCHVC    281 - 350
DKCFTRGNNLTVHLRKKHQFKWPSGHPRFRYKEHEDGYMRLQLVRYESVELTQQLLRQPQEGSGLGTSLN    351 - 420
ESSLQGIILETVPGEPGRKEEEEEGKGSEGTALSASQDNPSSVIHVVNQTNAQGQQEIVYYVLSEAPGEP    421 - 490
PPAPEPPSGGIMEKLQGIAEEPEIQMV                                               491 - 517
//

Text Mined References (22)

PMID Year Title