Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.40
PubTator Score 2.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Orofacial cleft 54 0.0 1.7
Disease Target Count Z-score Confidence
Myopia 176 3.8 1.9
Hyperopia 70 3.227 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
acute quadriplegic myopathy 1.296 1.3e-04
astrocytic glioma -1.900 1.6e-02
atypical teratoid / rhabdoid tumor -1.100 1.4e-04
group 3 medulloblastoma 1.200 7.6e-03
non-small cell lung cancer 1.172 8.6e-15
tuberculosis -1.700 2.4e-04

Gene RIF (1)

AA Sequence

MADDLGDEWWENQPTGAGSSPEASDGEGEGDTEVMQQETVPVPVPSEKTKQPKECFLIQPKERKENTTKT      1 - 70
RKRRKKKITDVLAKSEPKPGLPEDLQKLMKDYYSSRRLVIELEELNLPDSCFLKANDLTHSLSSYLKEIC     71 - 140
PKWVKLRKNHSEKKSVLMLIICSSAVRALELIRSMTAFRGDGKVIKLFAKHIKVQAQVKLLEKRVVHLGV    141 - 210
GTPGRIKELVKQGGLNLSPLKFLVFDWNWRDQKLRRMMDIPEIRKEVFELLEMGVLSLCKSESLKLGLF     211 - 279
//

Text Mined References (14)

PMID Year Title