Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.40
PubTator Score 2.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung cancer 2798 8.59698942251911E-15
acute quadriplegic myopathy 1157 1.29851759171108E-4
atypical teratoid / rhabdoid tumor 4369 1.43668331031214E-4
tuberculosis and treatment for 6 months 686 0.00336399045887088
group 3 medulloblastoma 2254 0.00761155352869618
astrocytic glioma 2241 0.0157076013869158
Disease Target Count Z-score Confidence
Orofacial cleft 38 0.0 1.0
Disease Target Count Z-score Confidence
Myopia 99 3.8 1.9
Hyperopia 33 3.253 1.6

Expression

  Differential Expression (6)

Synonym

Accession Q9BQ75 A8K5S7 B4DUM1 E9PHS3
Symbols C3orf26

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MADDLGDEWWENQPTGAGSSPEASDGEGEGDTEVMQQETVPVPVPSEKTKQPKECFLIQPKERKENTTKT      1 - 70
RKRRKKKITDVLAKSEPKPGLPEDLQKLMKDYYSSRRLVIELEELNLPDSCFLKANDLTHSLSSYLKEIC     71 - 140
PKWVKLRKNHSEKKSVLMLIICSSAVRALELIRSMTAFRGDGKVIKLFAKHIKVQAQVKLLEKRVVHLGV    141 - 210
GTPGRIKELVKQGGLNLSPLKFLVFDWNWRDQKLRRMMDIPEIRKEVFELLEMGVLSLCKSESLKLGLF     211 - 279
//

Text Mined References (14)

PMID Year Title
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
22863734 2012 Genome-wide meta-analyses of nonsyndromic cleft lip with or without cleft palate identify six new risk loci.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19160420 2009 Expression profiles of SV40-immortalization-associated genes upregulated in various human cancers.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...