Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.07
PubTator Score 0.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -2.400 0.000
osteosarcoma 2.521 0.000
atypical teratoid / rhabdoid tumor -1.100 0.002
pancreatic ductal adenocarcinoma liver m... -1.615 0.031
non primary Sjogren syndrome sicca 1.200 0.023
ulcerative colitis -1.200 0.001
ovarian cancer 2.000 0.000

AA Sequence

MIGDILLFGTLLMNAGAVLNFKLKKKDTQGFGEESREPSTGDNIREFLLSLRYFRIFIALWNIFMMFCMI      1 - 70
VLFGS                                                                      71 - 75
//

Text Mined References (5)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.