Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.07
PubTator Score 0.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 3.23674697505391E-10
psoriasis 6685 2.60821443334778E-5
ovarian cancer 8492 2.7623876020404E-4
ulcerative colitis 2087 5.93286282189955E-4
atypical teratoid / rhabdoid tumor 4369 0.00170464681920647
non primary Sjogren syndrome sicca 840 0.0232134208676031
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0306414420396855

Expression

  Differential Expression (7)

Disease log2 FC p
psoriasis -2.400 0.000
osteosarcoma 2.521 0.000
atypical teratoid / rhabdoid tumor -1.100 0.002
pancreatic ductal adenocarcinoma liver m... -1.615 0.031
non primary Sjogren syndrome sicca 1.200 0.023
ulcerative colitis -1.200 0.001
ovarian cancer 2.000 0.000

Synonym

Accession Q9BQ49 A8MX44
Symbols C19orf42

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Xenopus OMA EggNOG
Zebrafish OMA EggNOG

AA Sequence

MIGDILLFGTLLMNAGAVLNFKLKKKDTQGFGEESREPSTGDNIREFLLSLRYFRIFIALWNIFMMFCMI      1 - 70
VLFGS                                                                      71 - 75
//

Text Mined References (5)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.