Property Summary

NCBI Gene PubMed Count 5
PubMed Score 15.32
PubTator Score 4.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
pancreatic cancer 1.700 0.001
interstitial cystitis -4.300 0.000
spina bifida -2.881 0.044
Breast cancer -2.200 0.000
ovarian cancer 1.800 0.011

Gene RIF (1)

PMID Text
24891455 VGLL1 expression is associated with a triple-negative basal-like phenotype in breast cancer

AA Sequence

MEEMKKTAIRLPKGKQKPIKTEWNSRCVLFTYFQGDISSVVDEHFSRALSNIKSPQELTPSSQSEGVMLK      1 - 70
NDDSMSPNQWRYSSPWTKPQPEVPVTNRAANCNLHVPGPMAVNQFSPSLARRASVRPGELWHFSSLAGTS     71 - 140
SLEPGYSHPFPARHLVPEPQPDGKREPLLSLLQQDRCLARPQESAARENGNPGQIAGSTGLLFNLPPGSV    141 - 210
HYKKLYVSRGSASTSLPNETLSELETPGKYSLTPPNHWGHPHRYLQHL                          211 - 258
//

Text Mined References (5)

PMID Year Title
24891455 2014 VGLL1 expression is associated with a triple-negative basal-like phenotype in breast cancer.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10518497 1999 TONDU (TDU), a novel human protein related to the product of vestigial (vg) gene of Drosophila melanogaster interacts with vertebrate TEF factors and substitutes for Vg function in wing formation.