Property Summary

NCBI Gene PubMed Count 40
PubMed Score 88.11
PubTator Score 33.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
adrenocortical adenoma -1.761 1.1e-02
aldosterone-producing adenoma -1.997 1.5e-02
astrocytic glioma -1.400 4.4e-02
Breast cancer -1.400 5.2e-05
chronic rhinosinusitis -1.326 3.1e-02
colon cancer -1.500 2.1e-02
cystic fibrosis 2.409 8.9e-05
Gaucher disease type 1 -2.400 1.6e-02
group 3 medulloblastoma 1.800 1.3e-02
hereditary spastic paraplegia -1.800 8.8e-03
invasive ductal carcinoma -1.400 2.6e-02
lung cancer 3.100 4.4e-06
lung carcinoma -2.800 7.0e-39
malignant mesothelioma -2.000 1.9e-06
oligodendroglioma -1.300 3.3e-06
ovarian cancer -1.400 2.7e-11
pancreatic cancer 1.100 2.2e-02
pancreatic carcinoma 1.100 2.2e-02
Pick disease -1.100 1.9e-02
pituitary cancer -1.700 1.4e-03
posterior fossa group A ependymoma 1.500 2.9e-05
primary pancreatic ductal adenocarcinoma 3.056 1.6e-03
progressive supranuclear palsy -1.200 4.2e-02
psoriasis -3.100 5.7e-05
Rheumatoid arthritis 1.300 7.5e-03
sarcoidosis 1.100 4.4e-03

Protein-protein Interaction (9)

Gene RIF (19)

AA Sequence

MAFRTICVLVGVFICSICVKGSSQPQARVYLTFDELRETKTSEYFSLSHHPLDYRILLMDEDQDRIYVGS      1 - 70
KDHILSLNINNISQEALSVFWPASTIKVEECKMAGKDPTHGCGNFVRVIQTFNRTHLYVCGSGAFSPVCT     71 - 140
YLNRGRRSEDQVFMIDSKCESGKGRCSFNPNVNTVSVMINEELFSGMYIDFMGTDAAIFRSLTKRNAVRT    141 - 210
DQHNSKWLSEPMFVDAHVIPDGTDPNDAKVYFFFKEKLTDNNRSTKQIHSMIARICPNDTGGLRSLVNKW    211 - 280
TTFLKARLVCSVTDEDGPETHFDELEDVFLLETDNPRTTLVYGIFTTSSSVFKGSAVCVYHLSDIQTVFN    281 - 350
GPFAHKEGPNHQLISYQGRIPYPRPGTCPGGAFTPNMRTTKEFPDDVVTFIRNHPLMYNSIYPIHKRPLI    351 - 420
VRIGTDYKYTKIAVDRVNAADGRYHVLFLGTDRGTVQKVVVLPTNNSVSGELILEELEVFKNHAPITTMK    421 - 490
ISSKKQQLYVSSNEGVSQVSLHRCHIYGTACADCCLARDPYCAWDGHSCSRFYPTGKRRSRRQDVRHGNP    491 - 560
LTQCRGFNLKAYRNAAEIVQYGVKNNTTFLECAPKSPQASIKWLLQKDKDRRKEVKLNERIIATSQGLLI    561 - 630
RSVQGSDQGLYHCIATENSFKQTIAKINFKVLDSEMVAVVTDKWSPWTWASSVRALPFHPKDIMGAFSHS    631 - 700
EMQMINQYCKDTRQQHQQGDESQKMRGDYGKLKALINSRKSRNRRNQLPES                       701 - 751
//

Text Mined References (41)

PMID Year Title