Property Summary

NCBI Gene PubMed Count 30
Grant Count 41
R01 Count 25
Funding $5,208,654.29
PubMed Score 79.08
PubTator Score 33.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
Rheumatoid Arthritis 1.300 0.008
pancreatic cancer 2.700 0.001
malignant mesothelioma -2.000 0.000
astrocytic glioma -1.400 0.044
psoriasis -3.100 0.000
oligodendroglioma -1.300 0.000
cystic fibrosis 3.185 0.000
hereditary spastic paraplegia -1.800 0.009
adrenocortical adenoma -1.761 0.011
primary pancreatic ductal adenocarcinoma 3.056 0.002
lung cancer 3.200 0.000
colon cancer -1.500 0.021
sarcoidosis 1.100 0.004
group 3 medulloblastoma 1.900 0.033
posterior fossa group A ependymoma 2.100 0.000
pancreatic carcinoma 1.100 0.022
aldosterone-producing adenoma -1.997 0.015
inflammatory breast cancer -1.400 0.003
lung carcinoma -2.800 0.000
Pick disease -1.100 0.019
progressive supranuclear palsy -1.200 0.042
invasive ductal carcinoma -1.400 0.026
ovarian cancer -4.500 0.000
Gaucher disease type 1 -2.400 0.016
pituitary cancer -1.700 0.001
chronic rhinosinusitis -1.326 0.031

Gene RIF (16)

PMID Text
26977026 SEMA3C plays a role in the progression of breast cancer and may positively influence breast cancer cell adhesion, invasion and proliferation, as well as being associated with grade of disease and estrogen receptor status.
26286962 Data show significant increases in semaphorin3C, 3D and their receptor neuropilin-2 in degenerate samples which were shown to contain nerves and blood vessels, compared to non-degenerate samples without nerves and blood vessels.
26032848 Increased levels of Sema3C protein may be associated with the progression of glioma tumor and have potential as a prognostic marker for outcome of glioma patients.
25910410 SEMA3C expression increased in the transition from normal to malignant breast lesions and correlated with microvessel density and tumour grade and is differentially regulated in the development of breast versus oral neoplasia.
25839327 Functional loss of semaphorin 3C and/or semaphorin 3D and their epistatic interaction with ret are critical to Hirschsprung disease liability.
25808871 p65-Sema3C, but not FR-sema3C, rendered A549 lung cancer cells resistant to serum deprivation, suggesting that previously reported protumorigenic activities of sema3C may be due to p65-Sema3C produced by tumor cells
25464848 Glioma stem cells preferentially secrete Sema3C and coordinately express PlexinA2/D1 receptors to activate Rac1/nuclear factor (NF)-kB signaling.
23666167 SEMA3C is a novel adipokine regulated by weight changes.
22924992 Capillary-like tubular formation was reduced by the addition of culture media of sema3C miRNA cells.
22899844 The role of the motoneuronal Sema3 code could be to set population-specific axon sensitivity to limb-derived chemotropic Sema3 proteins, therefore specifying stereotyped motor nerve trajectories in their target field.
More...

AA Sequence

MAFRTICVLVGVFICSICVKGSSQPQARVYLTFDELRETKTSEYFSLSHHPLDYRILLMDEDQDRIYVGS      1 - 70
KDHILSLNINNISQEALSVFWPASTIKVEECKMAGKDPTHGCGNFVRVIQTFNRTHLYVCGSGAFSPVCT     71 - 140
YLNRGRRSEDQVFMIDSKCESGKGRCSFNPNVNTVSVMINEELFSGMYIDFMGTDAAIFRSLTKRNAVRT    141 - 210
DQHNSKWLSEPMFVDAHVIPDGTDPNDAKVYFFFKEKLTDNNRSTKQIHSMIARICPNDTGGLRSLVNKW    211 - 280
TTFLKARLVCSVTDEDGPETHFDELEDVFLLETDNPRTTLVYGIFTTSSSVFKGSAVCVYHLSDIQTVFN    281 - 350
GPFAHKEGPNHQLISYQGRIPYPRPGTCPGGAFTPNMRTTKEFPDDVVTFIRNHPLMYNSIYPIHKRPLI    351 - 420
VRIGTDYKYTKIAVDRVNAADGRYHVLFLGTDRGTVQKVVVLPTNNSVSGELILEELEVFKNHAPITTMK    421 - 490
ISSKKQQLYVSSNEGVSQVSLHRCHIYGTACADCCLARDPYCAWDGHSCSRFYPTGKRRSRRQDVRHGNP    491 - 560
LTQCRGFNLKAYRNAAEIVQYGVKNNTTFLECAPKSPQASIKWLLQKDKDRRKEVKLNERIIATSQGLLI    561 - 630
RSVQGSDQGLYHCIATENSFKQTIAKINFKVLDSEMVAVVTDKWSPWTWASSVRALPFHPKDIMGAFSHS    631 - 700
EMQMINQYCKDTRQQHQQGDESQKMRGDYGKLKALINSRKSRNRRNQLPES                       701 - 751
//

Publication (31)

PMID Year Title
26977026 2016 Expression of Semaphorin 3C in Breast Cancer and its Impact on Adhesion and Invasion of Breast Cancer Cells.
26286962 2015 Class 3 semaphorins expression and association with innervation and angiogenesis within the degenerate human intervertebral disc.
26032848 2015 High level of Sema3C is associated with glioma malignancy.
25910410 2015 The relationship between semaphorin 3C and microvessel density in the progression of breast and oral neoplasia.
25839327 2015 Functional loss of semaphorin 3C and/or semaphorin 3D and their epistatic interaction with ret are critical to Hirschsprung disease liability.
25808871 2015 Full-Length Semaphorin-3C Is an Inhibitor of Tumor Lymphangiogenesis and Metastasis.
25464848 2014 Sema3C promotes the survival and tumorigenicity of glioma stem cells through Rac1 activation.
23666167 2013 Semaphorin 3C is a novel adipokine linked to extracellular matrix composition.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22924992 2012 Semaphorin 3C is involved in the progression of gastric cancer.
More...