Property Summary

NCBI Gene PubMed Count 241
PubMed Score 482.84
PubTator Score 589.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
breast carcinoma -1.900 1.7e-03
ductal carcinoma in situ -2.000 2.0e-02
fibroadenoma -2.400 4.9e-02
interstitial cystitis -1.900 1.0e-02
lung adenocarcinoma -2.300 2.2e-18
medulloblastoma, large-cell 1.200 4.8e-05
osteosarcoma 1.738 1.7e-03
ovarian cancer 1.200 1.7e-09
psoriasis -2.300 8.3e-51

Gene RIF (228)

AA Sequence

MRFFCARCCSFGPEMPAVQLLLLACLVWDVGARTAQLRKANDQSGRCQYTFSVASPNESSCPEQSQAMSV      1 - 70
IHNLQRDSSTQRLDLEATKARLSSLESLLHQLTLDQAARPQETQEGLQRELGTLRRERDQLETQTRELET     71 - 140
AYSNLLRDKSVLEEEKKRLRQENENLARRLESSSQEVARLRRGQCPQTRDTARAVPPGSREVSTWNLDTL    141 - 210
AFQELKSELTEVPASRILKESPSGYLRSGEGDTGCGELVWVGEPLTLRTAETITGKYGVWMRDPKPTYPY    211 - 280
TQETTWRIDTVGTDVRQVFEYDLISQFMQGYPSKVHILPRPLESTGAVVYSGSLYFQGAESRTVIRYELN    281 - 350
TETVKAEKEIPGAGYHGQFPYSWGGYTDIDLAVDEAGLWVIYSTDEAKGAIVLSKLNPENLELEQTWETN    351 - 420
IRKQSVANAFIICGTLYTVSSYTSADATVNFAYDTGTGISKTLTIPFKNRYKYSSMIDYNPLEKKLFAWD    421 - 490
NLNMVTYDIKLSKM                                                            491 - 504
//

Text Mined References (249)

PMID Year Title