Property Summary

NCBI Gene PubMed Count 36
Grant Count 6
R01 Count 5
Funding $1,908,044.25
PubMed Score 9.86
PubTator Score 5.49

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
malignant mesothelioma 2.100 0.000
astrocytoma -3.800 0.003
ependymoma -2.900 0.000
oligodendroglioma -2.200 0.014
glioblastoma -3.600 0.000
osteosarcoma -1.344 0.009
sonic hedgehog group medulloblastoma -2.100 0.000
periodontitis -1.400 0.000
atypical teratoid / rhabdoid tumor -3.400 0.000
medulloblastoma, large-cell -2.900 0.000
primitive neuroectodermal tumor -2.100 0.001
non-small cell lung cancer -1.395 0.000
cystic fibrosis -1.400 0.001
pediatric high grade glioma -3.400 0.000
pilocytic astrocytoma -4.500 0.000
subependymal giant cell astrocytoma -3.774 0.006
spina bifida -2.338 0.036
Pick disease -1.800 0.006
pituitary cancer 2.600 0.000
psoriasis 1.300 0.000

Protein-protein Interaction (1)

Gene RIF (6)

PMID Text
22901147 Aberrant DNA methylation of SH3GL3 gene is associated with colorectal cancer.
21722156 SH3GL3 as a novel glioma invasion-associated candidate gene that likely contribute to the invasive phenotype of malignant gliomas.
20546612 Observational study of gene-disease association. (HuGE Navigator)
19308258 importance of hapln1b and sh3gl3 in embryonic vascular development
19266077 Observational study of gene-disease association. (HuGE Navigator)
18602463 These data implicate ataxin-2 to play a role in endocytic receptor cycling.[Endophilin A3]

AA Sequence

MSVAGLKKQFHKASQLFSEKISGAEGTKLDDEFLDMERKIDVTNKVVAEILSKTTEYLQPNPAYRAKLGM      1 - 70
LNTVSKIRGQVKTTGYPQTEGLLGDCMLKYGKELGEDSTFGNALIEVGESMKLMAEVKDSLDINVKQTFI     71 - 140
DPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGKIPDEEVRQAVEKFEESKELAERSMFNFLENDVE    141 - 210
QVSQLAVFIEAALDYHRQSTEILQELQSKLQMRISAASSVPRREYKPRPVKRSSSELNGVSTTSVVKTTG    211 - 280
SNIPMDQPCCRGLYDFEPENQGELGFKEGDIITLTNQIDENWYEGMIHGESGFFPINYVEVIVPLPQ       281 - 347
//

Publication (40)

PMID Year Title
24076656 2013 Endophilin, Lamellipodin, and Mena cooperate to regulate F-actin-dependent EGF-receptor endocytosis.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23285027 2012 Bin2 is a membrane sculpting N-BAR protein that influences leucocyte podosomes, motility and phagocytosis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22901147 2012 Genome-wide analysis of aberrant DNA methylation for identification of potential biomarkers in colorectal cancer patients.
21900206 2011 A directed protein interaction network for investigating intracellular signal transduction.
21722156 2012 Identification and functional validation of CDH11, PCSK6 and SH3GL3 as novel glioma invasion-associated candidate genes.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
20531441 2010 CAMOS, a nonprogressive, autosomal recessive, congenital cerebellar ataxia, is caused by a mutant zinc-finger protein, ZNF592.
More...