Property Summary

NCBI Gene PubMed Count 6
PubMed Score 59.66
PubTator Score 186.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung cancer 4740 2.4e-03
Disease Target Count Z-score Confidence
Pollen allergy 6 3.125 1.6
Pancytopenia 45 3.077 1.5

Gene RIF (3)

AA Sequence

MKSLTWILGLWALAACFTPGESQRGPRGPYPPGPLAPPPPPCFPFGTGFVPPPHPPPYGPGRFPPPLSPP      1 - 70
YGPGRIPPSPPPPYGPGRIQSHSLPPPYGPGYPQPPSQPRPYPPGPPFFPVNSPTDPALPTPAP           71 - 134
//

Text Mined References (7)

PMID Year Title