Property Summary

NCBI Gene PubMed Count 6
Grant Count 4
R01 Count 4
Funding $555,328.5
PubMed Score 56.34
PubTator Score 186.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Gene RIF (3)

PMID Text
26851015 High SMR3A expression is associated with aberrant differentiation into mucosal- or glandular-like cells in Adenoid Cystic Carcinoma of the Head and Neck.
18410445 All members of the human opiorphin family of genes can potentially modulate erectile physiology. Both hSMR3 and ProL1 are down-regulated in the corpora of men with ED, and therefore both genes can potentially act as markers of ED.
17512016 Results suggest that hSMR3A can act as a marker for erectile dysfunction associated with both diabetic and non-diabetic etiologies.

AA Sequence

MKSLTWILGLWALAACFTPGESQRGPRGPYPPGPLAPPPPPCFPFGTGFVPPPHPPPYGPGRFPPPLSPP      1 - 70
YGPGRIPPSPPPPYGPGRIQSHSLPPPYGPGYPQPPSQPRPYPPGPPFFPVNSPTDPALPTPAP           71 - 134
//

Text Mined References (7)

PMID Year Title
26851015 2016 Expression of Submaxillary Gland Androgen-regulated Protein 3A (SMR3A) in Adenoid Cystic Carcinoma of the Head and Neck.
18410445 2008 The opiorphin gene (ProL1) and its homologues function in erectile physiology.
17512016 2007 hSMR3A as a marker for patients with erectile dysfunction.
15851553 2005 The lacrimal gland transcriptome is an unusually rich source of rare and poorly characterized gene transcripts.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9354371 1997 Nucleotide sequence of gene PBI encoding a protein homologous to salivary proline-rich protein P-B.