Property Summary

NCBI Gene PubMed Count 15
PubMed Score 39.69
PubTator Score 9.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Latent syphilis 3 3.447 1.7

Expression

Gene RIF (5)

AA Sequence

MGSRAELCTLLGGFSFLLLLIPGEGAKGGSLRESQGVCSKQTLVVPLHYNESYSQPVYKPYLTLCAGRRI      1 - 70
CSTYRTMYRVMWREVRREVQQTHAVCCQGWKKRHPGALTCEAICAKPCLNGGVCVRPDQCECAPGWGGKH     71 - 140
CHVDVDECRTSITLCSHHCFNTAGSFTCGCPHDLVLGVDGRTCMEGSPEPPTSASILSVAVREAEKDERA    141 - 210
LKQEIHELRGRLERLEQWAGQAGAWVRAVLPVPPEELQPEQVAELWGRGDRIESLSDQVLLLEERLGACS    211 - 280
CEDNSLGLGVNHR                                                             281 - 293
//

Text Mined References (15)

PMID Year Title