Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.40
PubTator Score 4.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer 3.700 2.4e-02
hereditary spastic paraplegia -1.213 9.7e-04
lung adenocarcinoma 1.088 3.5e-05
Multiple myeloma 1.225 1.0e-02
osteosarcoma 1.493 8.5e-05
ovarian cancer -1.600 4.5e-04

Synonym

Accession Q99805 A8K399 Q2TAY5
Symbols P76

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MSARLPVLSPPRWPRLLLLSLLLLGAVPGPRRSGAFYLPGLAPVNFCDEEKKSDECKAEIELFVNRLDSV      1 - 70
ESVLPYEYTAFDFCQASEGKRPSENLGQVLFGERIEPSPYKFTFNKKETCKLVCTKTYHTEKAEDKQKLE     71 - 140
FLKKSMLLNYQHHWIVDNMPVTWCYDVEDGQRFCNPGFPIGCYITDKGHAKDACVISSDFHERDTFYIFN    141 - 210
HVDIKIYYHVVETGSMGARLVAAKLEPKSFKHTHIDKPDCSGPPMDISNKASGEIKIAYTYSVSFEEDDK    211 - 280
IRWASRWDYILESMPHTHIQWFSIMNSLVIVLFLSGMVAMIMLRTLHKDIARYNQMDSTEDAQEEFGWKL    281 - 350
VHGDIFRPPRKGMLLSVFLGSGTQILIMTFVTLFFACLGFLSPANRGALMTCAVVLWVLLGTPAGYVAAR    351 - 420
FYKSFGGEKWKTNVLLTSFLCPGIVFADFFIMNLILWGEGSSAAIPFGTLVAILALWFCISVPLTFIGAY    421 - 490
FGFKKNAIEHPVRTNQIPRQIPEQSFYTKPLPGIIMGGILPFGCIFIQLFFILNSIWSHQMYYMFGFLFL    491 - 560
VFIILVITCSEATILLCYFHLCAEDYHWQWRSFLTSGFTAVYFLIYAVHYFFSKLQITGTASTILYFGYT    561 - 630
MIMVLIFFLFTGTIGFFACFWFVTKIYSVVKVD                                         631 - 663
//

Text Mined References (14)

PMID Year Title