Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.00
PubTator Score 4.38

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
lung adenocarcinoma 2714 3.53738096996014E-5
osteosarcoma 7933 8.48397384164318E-5
hereditary spastic paraplegia 313 9.7329971031739E-4
ovarian cancer 8492 0.0024265951358688
Multiple myeloma 1328 0.0102088483678606
Breast cancer 3099 0.0238523710285762


  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.225 0.010
osteosarcoma 1.493 0.000
hereditary spastic paraplegia -1.213 0.001
Breast cancer 3.700 0.024
lung adenocarcinoma 1.088 0.000
ovarian cancer 2.100 0.002


Accession Q99805 A8K399 Q2TAY5
Symbols P76


PANTHER Protein Class (1)

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Zebrafish OMA Inparanoid
C. elegans OMA Inparanoid
S.cerevisiae OMA Inparanoid

 GO Process (1)

Gene RIF (2)

20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18187620 Knockdown of transmembrane 9 superfamily member 2 (TM9SF2) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MIMVLIFFLFTGTIGFFACFWFVTKIYSVVKVD                                         631 - 663

Text Mined References (13)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.