Property Summary

NCBI Gene PubMed Count 92
PubMed Score 121.67
PubTator Score 59.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
active Crohn's disease 1.061 2.9e-02
adult high grade glioma 1.300 1.4e-02
astrocytic glioma 1.500 3.9e-02
Astrocytoma, Pilocytic 1.100 1.9e-03
atypical teratoid / rhabdoid tumor 1.900 2.3e-04
ependymoma 1.900 2.4e-02
glioblastoma 1.100 4.2e-07
group 3 medulloblastoma 1.100 6.3e-03
juvenile dermatomyositis 1.057 5.4e-08
medulloblastoma, large-cell 2.100 4.7e-05
oligodendroglioma 1.600 2.4e-02
osteosarcoma 2.772 1.8e-06
ovarian cancer -1.200 1.2e-05
Pick disease 1.500 1.4e-06
primitive neuroectodermal tumor 1.800 3.8e-04
psoriasis -2.300 7.8e-04

Protein-protein Interaction (4)

Gene RIF (49)

AA Sequence

MTSMASLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSSPGQPSKCVTIPR      1 - 70
SLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLDICEFPFGSKQKEVCINPYHYKRVESPVLPPVL     71 - 140
VPRHNEFNPQHSLLVQFRNLSHNEPHMPQNATFPDSFHQPNNTPFPLSPNSPYPPSPASSTYPNSPASSG    141 - 210
PGSPFQLPADTPPPAYMPPDDQMGQDNSQPMDTSNNMIPQIMPSISSRDVQPVAYEEPKHWCSIVYYELN    211 - 280
NRVGEAFHASSTSVLVDGFTDPSNNKSRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSD    281 - 350
SSIFVQSRNCNFHHGFHPTTVCKIPSSCSLKIFNNQEFAQLLAQSVNHGFEAVYELTKMCTIRMSFVKGW    351 - 420
GAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPLNPISSVS                             421 - 465
//

Text Mined References (98)

PMID Year Title