Property Summary

NCBI Gene PubMed Count 88
Grant Count 63
R01 Count 39
Funding $5,215,867.8
PubMed Score 104.44
PubTator Score 59.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma 1.500 0.039
ependymoma 1.900 0.024
oligodendroglioma 1.600 0.024
psoriasis -2.300 0.001
glioblastoma 1.900 0.000
osteosarcoma 3.605 0.000
group 4 medulloblastoma 1.700 0.000
atypical teratoid / rhabdoid tumor 1.900 0.000
medulloblastoma, large-cell 2.100 0.000
primitive neuroectodermal tumor 1.800 0.000
juvenile dermatomyositis 1.058 0.000
active Crohn's disease 1.061 0.029
pediatric high grade glioma 1.600 0.000
pilocytic astrocytoma 1.400 0.000
Pick disease 1.500 0.000
ovarian cancer -2.300 0.000

Synonym

Accession Q99717 O14688 Q15798 Q9UQA1 MAD homolog 5
Symbols DWFC
JV5-1
MADH5

Gene

PANTHER Protein Class (1)

Gene RIF (47)

PMID Text
26809090 Our findings suggest that suppression of miR-222-3p activity promoted osteogenic differentiation hBMSCs through regulating Smad5-RUNX2 signaling axis.
26400397 miR-23a and miR-27a target SMAD5 and regulate apoptosis in human granulosa cells via the FasL-Fas pathway
26339396 Overexpression of the BMP4/SMAD4/SMAD5 signaling pathway could predict poor clinical outcome in skull base chordomas, suggesting activation of this pathway is involved in chordoma pathogenesis.
25880873 adult human Sertoli cells assumed similar morphological features, stable global gene expression profiles and numerous proteins, and activation of AKT and SMAD1/5 during long-period culture.
25754204 The polycomb group protein L3MBTL1 represses a SMAD5-mediated hematopoietic transcriptional program in human pluripotent stem cells.
25505291 balance between Smad1/5- and Smad2/3-dependent signaling defines the outcome of the effect of TGF-beta on atherosclerosis where Smad1/5 is responsible for proatherogenic effects
24928394 Our results indicated that KGN promoted the type-I collagen synthesis of dermal fibroblasts in vitro and in the dermis of mice through activation of the smad4/smad5 pathway.
24828823 Inhibiting Smurf1 mediated ubiquitination of Smad1/5.
24339730 Specific gene siRNAs knock-down further confirmed the osteogenic effects of Genistein on BMP2, SMAD5 and RUNX2 protein expression
24163009 among the 15 SNPs, rs3206634 was significantly associated with KD in a recessive model (odds ratio = 2.31, p = 0.019), whereas there was no association between any of the 15 SNPs and CALs.
More...

AA Sequence

MTSMASLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSSPGQPSKCVTIPR      1 - 70
SLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLDICEFPFGSKQKEVCINPYHYKRVESPVLPPVL     71 - 140
VPRHNEFNPQHSLLVQFRNLSHNEPHMPQNATFPDSFHQPNNTPFPLSPNSPYPPSPASSTYPNSPASSG    141 - 210
PGSPFQLPADTPPPAYMPPDDQMGQDNSQPMDTSNNMIPQIMPSISSRDVQPVAYEEPKHWCSIVYYELN    211 - 280
NRVGEAFHASSTSVLVDGFTDPSNNKSRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSD    281 - 350
SSIFVQSRNCNFHHGFHPTTVCKIPSSCSLKIFNNQEFAQLLAQSVNHGFEAVYELTKMCTIRMSFVKGW    351 - 420
GAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPLNPISSVS                             421 - 465
//

Text Mined References (94)

PMID Year Title
26809090 2016 Inhibition of miR-222-3p activity promoted osteogenic differentiation of hBMSCs by regulating Smad5-RUNX2 signal axis.
26400397 2015 miR-23a and miR-27a promote human granulosa cell apoptosis by targeting SMAD5.
26339396 2015 Overexpression of the BMP4/SMAD signaling pathway in skull base chordomas is associated with poor prognosis.
25880873 2015 Long-term culture and significant expansion of human Sertoli cells whilst maintaining stable global phenotype and AKT and SMAD1/5 activation.
25754204 2015 The polycomb group protein L3MBTL1 represses a SMAD5-mediated hematopoietic transcriptional program in human pluripotent stem cells.
25505291 2015 TGF-?1, but not bone morphogenetic proteins, activates Smad1/5 pathway in primary human macrophages and induces expression of proatherogenic genes.
24928394 2014 A heterocyclic molecule kartogenin induces collagen synthesis of human dermal fibroblasts by activating the smad4/smad5 pathway.
24828823 2014 Selective small molecule compounds increase BMP-2 responsiveness by inhibiting Smurf1-mediated Smad1/5 degradation.
24518599 2014 Prostate cancer bone metastases acquire resistance to androgen deprivation via WNT5A-mediated BMP-6 induction.
24449884 2014 Different modes of endothelial-smooth muscle cell interaction elicit differential ?-catenin phosphorylations and endothelial functions.
More...