Property Summary

NCBI Gene PubMed Count 142
PubMed Score 433.82
PubTator Score 412.12

Knowledge Summary


No data available


  Disease Sources (6)


  Differential Expression (9)

Disease log2 FC p
medulloblastoma, large-cell 2.600 0.005
non-small cell lung cancer 1.142 0.000
lung cancer 3.100 0.000
interstitial cystitis -1.100 0.010
sonic hedgehog group medulloblastoma 1.800 0.004
spina bifida -2.096 0.034
ulcerative colitis -3.200 0.000
pituitary cancer 2.700 0.000
psoriasis -1.200 0.000


Accession Q99697 A8K6C6 B2RA02 B3KXS0 O60578 O60579 O60580 Q3KQX9 Q9BY17
Symbols RS



2L7F   2L7M   2LKX  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (114)

26783232 PANCR knockdown decreased PITX2c expression in differentiated cardiomyocytes, altering the transcriptome in a manner similar to PITX2c knockdown.
26657035 A novel loss-of-function PITX2 mutation (Q102L) co-segregated with tetralogy of Fallot with complete penetrance.
26400846 Expression of PITX2 in BM of early-stage breast cancer patients is associated with risk for early disease recurrence.
26298390 Our study uncovers the PITX2-induced expression of TGFB1/2/3 as well as INHBA genes (p < 0.01) followed by SMAD2/3-dependent TGF-b signalling pathway in ovarian cancer cells
26267381 Both ZFHX3 and PITX2c regulate expression of NPPA, TBX5 and NKX2.5.
25893250 PITX2 loss-of-function mutation has a role in increased susceptibility to Congenital Endocardial Cushion Defect and Axenfeld-Rieger Syndrome
25704760 Pitx2-mediated repression of Depdc1b expression contributes to the regulation of multiple molecular pathways, such as Rho GTPase signaling.
25494715 The results suggest an association between PITX2-related SNPs and dementia.
25443231 Single nucleotide polymorphism (rs2200733) located in proximity of the gene PITX2 (paired-like homeodomain transcription factor 2) was highly associated with atrial fibrillation.
25402584 study strengthens prior findings that PITX2 methylation is useful as a biomarker of poor outcome of PCa and in addition we also suggest that it may be particularly useful in men with low Gleason score.

AA Sequence

LASLRLKAKQHSSFGYASVQNPASNLSACQYAVDRPV                                     281 - 317

Text Mined References (143)

PMID Year Title
26783232 2016 PANCR, the PITX2 Adjacent Noncoding RNA, Is Expressed in Human Left Atria and Regulates PITX2c Expression.
26657035 2016 PITX2 loss-of-function mutation contributes to tetralogy of Fallot.
26400846 2015 Paired-like Homeodomain Transcription factor 2 expression by breast cancer bone marrow disseminated tumor cells is associated with early recurrent disease development.
26298390 2015 Invasion of ovarian cancer cells is induced byPITX2-mediated activation of TGF-? and Activin-A.
26267381 2015 Molecular Basis of Gene-Gene Interaction: Cyclic Cross-Regulation of Gene Expression and Post-GWAS Gene-Gene Interaction Involved in Atrial Fibrillation.
25893250 2015 PITX2 Loss-of-Function Mutation Contributes to Congenital Endocardial Cushion Defect and Axenfeld-Rieger Syndrome.
25704760 2015 Identification of the GTPase-activating protein DEP domain containing 1B (DEPDC1B) as a transcriptional target of Pitx2.
25494715 2015 Incidence of dementia in relation to genetic variants at PITX2, ZFHX3, and ApoE ?4 in atrial fibrillation patients.
25443231 2014 Risk factors and genetics of atrial fibrillation.
25402584 2014 DNA methylation of PITX2 predicts poor survival in men with prostate cancer.