Property Summary

NCBI Gene PubMed Count 44
PubMed Score 25.04
PubTator Score 40.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
active Crohn's disease 1.380 4.2e-02
active ulcerative colitis 1.491 3.8e-02
adrenocortical carcinoma 1.365 3.9e-02
atypical teratoid/rhabdoid tumor -1.100 3.4e-03
Breast cancer -1.300 5.4e-14
colon cancer -1.200 3.4e-03
ductal carcinoma in situ -1.200 2.9e-02
group 3 medulloblastoma -1.500 4.3e-02
intraductal papillary-mucinous adenoma (... -1.600 3.5e-03
intraductal papillary-mucinous carcinoma... -1.800 3.8e-03
intraductal papillary-mucinous neoplasm ... -1.800 1.8e-02
invasive ductal carcinoma -2.000 2.5e-03
lung adenocarcinoma -1.200 1.3e-14
lung cancer -2.200 2.9e-04
lung carcinoma -1.200 2.0e-10
malignant mesothelioma 1.700 2.7e-06
medulloblastoma, large-cell -3.000 1.6e-06
non-small cell lung cancer -1.063 6.1e-07
subependymal giant cell astrocytoma -1.198 1.8e-02
tuberculosis -1.600 4.4e-04
type I diabetes mellitus -1.131 2.6e-02

Gene RIF (33)

AA Sequence

MEAPLVSLDEEFEDLRPSCSEDPEEKPQCFYGSSPHHLEDPSLSELENFSSEIISFKSMEDLVNEFDEKL      1 - 70
NVCFRNYNAKTENLAPVKNQLQIQEEEETLQDEEVWDALTDNYIPSLSEDWRDPNIEALNGNCSDTEIHE     71 - 140
KEEEEFNEKSENDSGINEEPLLTADQVIEEIEEMMQNSPDPEEEEEVLEEEDGGETSSQADSVLLQEMQA    141 - 210
LTQTFNNNWSYEGLRHMSGSELTELLDQVEGAIRDFSEELVQQLARRDELEFEKEVKNSFITVLIEVQNK    211 - 280
QKEQRELMKKRRKEKGLSLQSSRIEKGNQMPLKRFSMEGISNILQSGIRQTFGSSGTDKQYLNTVIPYEK    281 - 350
KASPPSVEDLQMLTNILFAMKEDNEKVPTLLTDYILKVLCPT                                351 - 392
//

Text Mined References (45)

PMID Year Title