Property Summary

NCBI Gene PubMed Count 43
PubMed Score 23.84
PubTator Score 40.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
Breast cancer 3099 5.4418077552117E-14
lung adenocarcinoma 2714 8.88929790500408E-14
lung carcinoma 2844 1.96860424755117E-10
group 4 medulloblastoma 1875 3.42196928718808E-8
non-small cell lung cancer 2798 6.12432527983832E-7
medulloblastoma, large-cell 6234 1.56599986307522E-6
malignant mesothelioma 3163 2.69833923E-6
ulcerative colitis 2087 2.88130308339956E-5
tuberculosis and treatment for 6 months 686 8.96474763290827E-5
lung cancer 4473 2.87958514214161E-4
invasive ductal carcinoma 2950 0.00251087339340637
atypical teratoid/rhabdoid tumor 1095 0.00341988757538954
colon cancer 1475 0.00343735593556609
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00353531899808384
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00379838191408734
subependymal giant cell astrocytoma 2287 0.0177338612197788
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0180238426155728
type I diabetes mellitus 22 0.026430055319884
ductal carcinoma in situ 1745 0.0292513589008218
adrenocortical carcinoma 1427 0.0391701831489015
active Crohn's disease 918 0.0417449864300183
Disease Target Count Z-score Confidence
Schizophrenia 503 3.588 1.8
Bipolar Disorder 266 0.0 1.0

Expression

Synonym

Accession Q99689 O00679 O00728 Q6IBI7
Symbols UNC-76

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid

 GWAS Trait (1)

Gene RIF (33)

PMID Text
25818806 FEZ1 promotes HIV-1 infection in non-neuronal cells via direct binding to the capsid and kinesin-1 to move the virus into the cell nucleus.
25818806 The ability of exogenously expressed FEZ1 binding to kinesin-1 to promote early HIV-1 infection, leading to the movement of HIV-1 CA core to the nucleus
25818806 RNAi-mediated FEZ1 depletion inhibits early infection, with virus particles exhibiting bi-directional motility but no net movement to the nucleus
24116125 Studies indicate that FEZ1 (fasciculation and elongation protein zeta 1), SCOCO (short coiled-coil protein) and kinesins (kinesin heavy chain) are involved in biological transport process.
24098481 SCOC forms a stable homogeneous complex with the coiled coil domain of FEZ1. SCOC dimerization and the SCOC surface residue R117 are important for this interaction.
22832604 Short Disrupted-in-Schizophrenia (DISC)1 splice variants show reduced or no binding to NDEL1 and phosphodiesterase (PDE)4B proteins but fully interact with FEZ1 and GSK3beta.
22451907 FEZ1 operates as a kinesin adaptor for the transport of Stx, with cargo loading and unloading being regulated by protein kinases.
22099459 Genetic association analysis of two independent cohorts of schizophrenia patients and healthy controls reveals an epistatic interaction between FEZ1 and disrupted in schizophrenia (DISC)1.
22017218 The data of this study suggested that FEZ1 may play important roles in human astrocytes, and that mood stabilizers might exert their cytoprotective and mood-stabilizing effects by inducing FEZ1 expression in astrocytes.
21408165 FEZ2 interacted with 59 proteins and that of these only 40 interacted with FEZ1.
More...

AA Sequence

MEAPLVSLDEEFEDLRPSCSEDPEEKPQCFYGSSPHHLEDPSLSELENFSSEIISFKSMEDLVNEFDEKL      1 - 70
NVCFRNYNAKTENLAPVKNQLQIQEEEETLQDEEVWDALTDNYIPSLSEDWRDPNIEALNGNCSDTEIHE     71 - 140
KEEEEFNEKSENDSGINEEPLLTADQVIEEIEEMMQNSPDPEEEEEVLEEEDGGETSSQADSVLLQEMQA    141 - 210
LTQTFNNNWSYEGLRHMSGSELTELLDQVEGAIRDFSEELVQQLARRDELEFEKEVKNSFITVLIEVQNK    211 - 280
QKEQRELMKKRRKEKGLSLQSSRIEKGNQMPLKRFSMEGISNILQSGIRQTFGSSGTDKQYLNTVIPYEK    281 - 350
KASPPSVEDLQMLTNILFAMKEDNEKVPTLLTDYILKVLCPT                                351 - 392
//

Text Mined References (44)

PMID Year Title
25818806 2015 HIV-1 capsids bind and exploit the kinesin-1 adaptor FEZ1 for inward movement to the nucleus.
25495476 2014 RAB3GAP1 and RAB3GAP2 modulate basal and rapamycin-induced autophagy.
24116125 2013 Structural analysis of intermolecular interactions in the kinesin adaptor complex fasciculation and elongation protein zeta 1/ short coiled-coil protein (FEZ1/SCOCO).
24098481 2013 Crystal structure of the human short coiled coil protein and insights into SCOC-FEZ1 complex formation.
23894747 2013 A comprehensive family-based replication study of schizophrenia genes.
22832604 2011 Interactions of human truncated DISC1 proteins: implications for schizophrenia.
22688191 2012 Genome-wide association study in a Swedish population yields support for greater CNV and MHC involvement in schizophrenia compared with bipolar disorder.
22451907 2012 Phosphorylation-regulated axonal dependent transport of syntaxin 1 is mediated by a Kinesin-1 adapter.
22354037 2012 Genome-wide siRNA screen reveals amino acid starvation-induced autophagy requires SCOC and WAC.
22099459 2011 Interaction between FEZ1 and DISC1 in regulation of neuronal development and risk for schizophrenia.
More...