Property Summary

NCBI Gene PubMed Count 10
PubMed Score 1.98
PubTator Score 2.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytoma -1.400 0.005
colon cancer -1.300 0.038
ovarian cancer -1.300 0.000

Gene RIF (3)

PMID Text
24680596 CGRRF1 represents a novel, reproducible tissue marker of metformin response in the obese endometrium and our preliminary data suggests that up-regulation of CGRRF1 expression may prove clinically useful in the prevention or treatment of endometrial cancer
20677014 Observational study of gene-disease association. (HuGE Navigator)
12070015 Novel transcription factors identified in human CD34 antigen-positive hematopoietic stem cells.

AA Sequence

MAAVFLVTLYEYSPLFYIAVVFTCFIVTTGLVLGWFGWDVPVILRNSEETQFSTRVFKKQMRQVKNPFGL      1 - 70
EITNPSSASITTGITLTTDCLEDSLLTCYWGCSVQKLYEALQKHVYCFRISTPQALEDALYSEYLYQEQY     71 - 140
FIKKDSKEEIYCQLPRDTKIEDFGTVPRSRYPLVALLTLADEDDREIYDIISMVSVIHIPDRTYKLSCRI    141 - 210
LYQYLLLAQGQFHDLKQLFMSANNNFTPSNNSSSEEKNTDRSLLEKVGLSESEVEPSEENSKDCVVCQNG    211 - 280
TVNWVLLPCRHTCLCDGCVKYFQQCPMCRQFVQESFALCSQKEQDKDKPKTL                      281 - 332
//

Text Mined References (11)

PMID Year Title
24680596 2014 CGRRF1 as a novel biomarker of tissue response to metformin in the context of obesity.
23259602 2012 Genome-wide association scan of dental caries in the permanent dentition.
22361696 2012 Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12070015 2002 Novel transcription factors in human CD34 antigen-positive hematopoietic cells.
More...