Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.11
PubTator Score 2.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 3.7e-05
astrocytoma 1146 4.7e-03
colon cancer 1478 3.8e-02
Disease Target Count Z-score Confidence
Estrogen excess 4 3.662 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytoma -1.400 4.7e-03
colon cancer -1.300 3.8e-02
ovarian cancer -1.300 3.7e-05

Gene RIF (3)

AA Sequence

MAAVFLVTLYEYSPLFYIAVVFTCFIVTTGLVLGWFGWDVPVILRNSEETQFSTRVFKKQMRQVKNPFGL      1 - 70
EITNPSSASITTGITLTTDCLEDSLLTCYWGCSVQKLYEALQKHVYCFRISTPQALEDALYSEYLYQEQY     71 - 140
FIKKDSKEEIYCQLPRDTKIEDFGTVPRSRYPLVALLTLADEDDREIYDIISMVSVIHIPDRTYKLSCRI    141 - 210
LYQYLLLAQGQFHDLKQLFMSANNNFTPSNNSSSEEKNTDRSLLEKVGLSESEVEPSEENSKDCVVCQNG    211 - 280
TVNWVLLPCRHTCLCDGCVKYFQQCPMCRQFVQESFALCSQKEQDKDKPKTL                      281 - 332
//

Text Mined References (12)

PMID Year Title