Property Summary

NCBI Gene PubMed Count 20
PubMed Score 0.00
PubTator Score 210.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 7.6e-05
oligodendroglioma 2850 6.5e-03
ependymoma 4679 1.9e-02

Expression

  Differential Expression (3)

Disease log2 FC p
ependymoma 1.500 1.9e-02
oligodendroglioma 1.200 6.5e-03
osteosarcoma 1.087 7.6e-05

Gene RIF (6)

AA Sequence

MEAPLQTEMVELVPNGKHSEGLLPVITPMAGNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGKTSFGM      1 - 70
SVFNLSNAIMGSGILGLAYAMANTGIILFLFLLTAVALLSSYSIHLLLKSSGVVGIRAYEQLGYRAFGTP     71 - 140
GKLAAALAITLQNIGAMSSYLYIIKSELPLVIQTFLNLEEKTSDWYMNGNYLVILVSVTIILPLALMRQL    141 - 210
GYLGYSSGFSLSCMVFFLIAVIYKKFHVPCPLPPNFNNTTGNFSHVEIVKEKVQLQVEPEASAFCTPSYF    211 - 280
TLNSQTAYTIPIMAFAFVCHPEVLPIYTELKDPSKKKMQHISNLSIAVMYIMYFLAALFGYLTFYNGVES    281 - 350
ELLHTYSKVDPFDVLILCVRVAVLTAVTLTVPIVLFPVRRAIQQMLFPNQEFSWLRHVLIAVGLLTCINL    351 - 420
LVIFAPNILGIFGVIGATSAPFLIFIFPAIFYFRIMPTEKEPARSTPKILALCFAMLGFLLMTMSLSFII    421 - 490
IDWASGTSRHGGNH                                                            491 - 504
//

Text Mined References (23)

PMID Year Title