Property Summary

NCBI Gene PubMed Count 54
Grant Count 113
R01 Count 67
Funding $17,291,703.94
PubMed Score 882.01
PubTator Score 450.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Synonym

Accession Q99623 B4DP75 Q2YDA4 Q7KYU3 Q92978
Symbols BAP
REA
p22
hBAP
Bap37
BCAP37
PNAS-141

Gene

Gene RIF (39)

PMID Text
26653759 REA modulates cross talk among multiple cell types in the uterine tissue and host background, serving as a brake on the estradiol-ER axis and restraining multiple aspects that contribute to the pathologic progression of endometriosis.
26497683 Fluorizoline bind to prohibitin, inducing mitochondrial apoptotic pathway through NOXA and BIM upregulation.
26052702 BIG3 may block the KPNAs (KPNA1, KPNA5, and KPNA6) binding region(s) of PHB2.
26049107 results show that PHB2 binds to the ligand binding domain of ERalpha with a conformational change in the helix 12 of ERalpha
25910425 Functional analysis of selected regulated proteins revealed that knockdown of HNRPD, PHB2 and UB2V2 can increase HCMV replication, while knockdown of A4 and KSRP resulted in decreased HCMV replication.
25769926 These results demonstrate that estradiol upregulates REA expression and recruits REA via ERalpha to the EREs on the RORgammaT promoter region, thus inhibiting RORgammaT expression and Th17 differentiation.
25200157 Data indicate that the up-regulated expression of prohibitin promoted acute promyelocytic leukemia cell line NB4-R1 cell apoptosis.
24997568 BIG3 (ARFGEF3) is predicted to interact with its partner PHB2 through an ARM-type alpha-helical structure.
24522204 Prohibitin 2 acts as a nuclear AKT substrate during all-trans retinoic acid-induced differentiation of acute promyelocytic leukemia cells
24388982 prohibitin and prohibiton (PHB2) contribute to PIG3-mediated apoptosis by binding to the PIG3 promoter (TGYCC)15 motif
More...

AA Sequence

MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHF      1 - 70
RIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEV     71 - 140
LKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRA    141 - 210
QFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVL    211 - 280
NLQDESFTRGSDSLIKGKK                                                       281 - 299
//

Text Mined References (63)

PMID Year Title
26653759 2016 Multiple Beneficial Roles of Repressor of Estrogen Receptor Activity (REA) in Suppressing the Progression of Endometriosis.
26497683 2015 A novel prohibitin-binding compound induces the mitochondrial apoptotic pathway through NOXA and BIM upregulation.
26052702 2015 BIG3 Inhibits the Estrogen-Dependent Nuclear Translocation of PHB2 via Multiple Karyopherin-Alpha Proteins in Breast Cancer Cells.
26049107 2015 Differential binding of prohibitin-2 to estrogen receptor ? and to drug-resistant ER? mutants.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25910425 2015 Subcellular quantitative proteomic analysis reveals host proteins involved in human cytomegalovirus infection.
25769926 2015 Estradiol inhibits Th17 cell differentiation through inhibition of ROR?T transcription by recruiting the ER?/REA complex to estrogen response elements of the ROR?T promoter.
25200157 2014 [Over-expression of prohibitin gene promotes apoptosis in retinoic acid-resistant acute promyelocytic leukemia cell line NB4-R1].
24997568 2014 Brefeldin A-inhibited guanine nucleotide-exchange protein 3 (BIG3) is predicted to interact with its partner through an ARM-type ?-helical structure.
24522204 2014 Prohibitin 2 represents a novel nuclear AKT substrate during all-trans retinoic acid-induced differentiation of acute promyelocytic leukemia cells.
More...