Property Summary

NCBI Gene PubMed Count 9
PubMed Score 144.66
PubTator Score 149.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Intellectual disability 1016 0.0 4.0
Temtamy syndrome 1 0.0 0.0
Disease Target Count Z-score Confidence
Coloboma 51 3.212 1.6
Lagophthalmos 9 3.035 1.5

Expression

Synonym

Accession Q99622 B2R4Q6
Symbols C10
GRCC10

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Gene RIF (3)

AA Sequence

MASASTQPAALSAEQAKVVLAEVIQAFSAPENAVRMDEARDNACNDMGKMLQFVLPVATQIQQEVIKAYG      1 - 70
FSCDGEGVLKFARLVKSYEAQDPEIASLSGKLKALFLPPMTLPPHGPAAGGSVAAS                   71 - 126
//

Text Mined References (13)

PMID Year Title