Property Summary

NCBI Gene PubMed Count 133
PubMed Score 239.38
PubTator Score 240.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
lung carcinoma 2844 1.16722726617447E-26
non-small cell lung cancer 2798 4.0606396567593E-23
lung adenocarcinoma 2714 3.49001996012826E-13
juvenile dermatomyositis 1189 2.18116802691086E-11
ovarian cancer 8492 2.27741772341E-7
malignant mesothelioma 3163 4.63142183112404E-7
lung cancer 4473 1.06399399814065E-6
acute quadriplegic myopathy 1157 1.4306676420948E-6
pituitary cancer 1972 1.11733163158479E-5
medulloblastoma, large-cell 6234 4.49661213218916E-5
osteosarcoma 7933 1.02073469432771E-4
breast carcinoma 1614 2.59229256964962E-4
primary pancreatic ductal adenocarcinoma 1271 2.92502488307306E-4
group 4 medulloblastoma 1875 3.27804259252828E-4
pancreatic cancer 2300 6.47555134647085E-4
psoriasis 6685 6.67364716718937E-4
autosomal dominant Emery-Dreifuss muscular dystrophy 499 8.11265180720351E-4
inflammatory breast cancer 404 0.00211196531789476
glioblastoma 5572 0.00401012456812923
astrocytoma 1493 0.00509357568539653
Rheumatoid Arthritis 1171 0.0072416331395997
chronic rhinosinusitis 512 0.00958705147785074
gastric carcinoma 832 0.0107570611815102
interstitial lung disease 292 0.0132625968747903
cystic fibrosis and chronic rhinosinusitis 213 0.0166432967768378
pancreatic carcinoma 567 0.0273992812203903
fibroadenoma 557 0.0310306334847833
subependymal giant cell astrocytoma 2287 0.0342009396983407
acute myeloid leukemia 785 0.0410793384588044
aldosterone-producing adenoma 664 0.0423918108081183
Disease Target Count Z-score Confidence
Prostate cancer 172 0.0 5.0
Disease Target Count Z-score Confidence
Cancer 2346 4.007 2.0
Disease Target Count
gastric cancer 436

Expression

Synonym

Accession Q99612 B2RE86 B4DDN0 D3DRR1 F5H3M5 Q5VUT7 Q5VUT8 Q9BT79
Symbols GBF
ZF9
BCD1
CBA1
CPBP
PAC1
ST12
COPEB

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Zebrafish EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (123)

PMID Text
26193637 KLF6 overexpression partially phenocopied chaetocin treatment in DDLPS cells and induced phenotypic changes that were consistent with adipocytic differentiation, suggesting that the effects of increased H3K9me3 may be mediated through KLF6
25686501 Palmitic acid increases Ppargamma and Klf6 & Klf9 gene expression and promotes triglyceride accumulation in HepG2 cells.
25652467 In this review, we focus on the functions, roles, and regulatory networks of these five KLFs in HCC, summarize key pathways, and propose areas for further investigation
25537765 KLF6 is a novel regulator of human villous trophoblast fusion.
25230316 Study revealed that overexpression of miR-101 inhibited the proliferation, cell migration, invasion, and promoted apoptosis of glioblastoma stem cells by directly targeting KLF6
25182666 the possibility that overexpression of miR-181a contributes to the increased permeability of BTB by targeting KLF6, thereby revealing potential therapeutic targets for the treatment of brain gliomas.
24921656 Data show that MiR-1301 and miR-210 specifically target the tumor suppressive KLF6-FL isoform but not the oncogenic KLF6-SV1 isoform in hepatocellular carcinoma.
24634218 Data indicate that upon IL-1beta stimulation, Kruppel-like factor 6 (KLF6) was recruited to promoters of a subset of NF-kappaB target genes in a p65-dependent manner, which was in turn required for the optimal binding of p65 to the target gene promoters.
24519062 Downregulation of KLF6 during the progression of breast cancer is independent of the mutations and occurs by a different mechanism.
24385430 KLF6 is required for optimal LPS-induced pro-inflammatory gene expression, acting cooperatively with NF-kappaB
More...

AA Sequence

MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQEDLWTKIILA      1 - 70
REKKEESELKISSSPPEDTLISPSFCYNLETNSLNSDVSSESSDSSEELSPTAKFTSDPIGEVLVSSGKL     71 - 140
SSSVTSTPPSSPELSREPSQLWGCVPGELPSPGKVRSGTSGKPGDKGNGDASPDGRRRVHRCHFNGCRKV    141 - 210
YTKSSHLKAHQRTHTGEKPYRCSWEGCEWRFARSDELTRHFRKHTGAKPFKCSHCDRCFSRSDHLALHMK    211 - 280
RHL                                                                       281 - 283
//

Text Mined References (134)

PMID Year Title
26193637 2015 Increased H3K9me3 drives dedifferentiated phenotype via KLF6 repression in liposarcoma.
25686501 2015 The activation of peroxisome proliferator-activated receptor ? is regulated by Krüppel-like transcription factors 6 & 9 under steatotic conditions.
25652467 2015 Krüppel-like factors in hepatocellular carcinoma.
25537765 2015 A novel regulator of human villous trophoblast fusion: the Krüppel-like factor 6.
25230316 2015 miR-101 acts as a tumor suppressor by targeting Kruppel-like factor 6 in glioblastoma stem cells.
25182666 2014 MiR-181a regulates blood-tumor barrier permeability by targeting Krüppel-like factor 6.
24921656 2014 Identification of miRNAs that specifically target tumor suppressive KLF6-FL rather than oncogenic KLF6-SV1 isoform.
24634218 2014 Krüppel-like factor 6 is a co-activator of NF-?B that mediates p65-dependent transcription of selected downstream genes.
24519062 2014 Mutations and Krüppel-like factor 6 (KLF6) expression levels in breast cancer.
24385430 2014 Kruppel-like transcription factor 6 regulates inflammatory macrophage polarization.
More...