Property Summary

NCBI Gene PubMed Count 27
Grant Count 6
R01 Count 2
Funding $1,468,160
PubMed Score 115.42
PubTator Score 21.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Synonym

Accession Q99551 A4D1E3 Q32NF8 Q53H51 Q9BVR7
Symbols MTERF

Gene

PANTHER Protein Class (1)

PDB

3MVA   3MVB   3N6S   3N7Q   5CKY   5CO0   5CRJ   5CRK  

Gene RIF (13)

PMID Text
21450691 data suggested that hMTERF4 is an essential factor for cell proliferation, which is probably modulated by mitochondrial transcription to promote cell proliferation
21447778 Single nucleotide polymorphism in MTERF gene is associated with epithelial ovarian cancer.
21326908 Studies indicate that the structure of the mitochondrial transcription termination factor (MTERF1) provides insight into the mechanism of binding, recognition of the termination sequence and the conformational changes involved in mediating termination.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20846394 Data show that mTERF protein levels materially affect the amount of readthrough transcription on the antisense strand of mtDNA, whilst the effects on sense-strand transcripts are complex, and suggest the influence of compensatory mechanisms.
20550934 The structure indicates that upon sequence recognition MTERF1 unwinds the DNA molecule, promoting eversion of three nucleotides.
20543826 Presented are the crystal structures of human mitochondrial regulator MTERF, a transcription termination factor also implicated in replication pausing, in complex with double-stranded DNA oligonucleotides containing the tRNA(Leu)(UUR) gene sequence.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19681768 mTERF mRNA levels were higher in elite athletes compared with moderately active subjects
17884915 Results indicate a role for mTERF in mtDNA replication, in addition to its role in transcription.
More...

AA Sequence

MQSLSLGQTSISKGLNYLTIMAPGNLWHMRNNFLFGSRCWMTRFSAENIFKSVSFRLFGVKCHNTDSEPL      1 - 70
KNEDLLKNLLTMGVDIDMARKRQPGVFHRMITNEQDLKMFLLSKGASKEVIASIISRYPRAITRTPENLS     71 - 140
KRWDLWRKIVTSDLEIVNILERSPESFFRSNNNLNLENNIKFLYSVGLTRKCLCRLLTNAPRTFSNSLDL    141 - 210
NKQMVEFLQAAGLSLGHNDPADFVRKIIFKNPFILIQSTKRVKANIEFLRSTFNLNSEELLVLICGPGAE    211 - 280
ILDLSNDYARRSYANIKEKLFSLGCTEEEVQKFVLSYPDVIFLAEKKFNDKIDCLMEENISISQIIENPR    281 - 350
VLDSSISTLKSRIKELVNAGCNLSTLNITLLSWSKKRYEAKLKKLSRFA                         351 - 399
//

Text Mined References (27)

PMID Year Title
24598254 2014 A bifunctional protein regulates mitochondrial protein synthesis.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21450691 2011 hMTERF4 knockdown in HeLa cells results in sub-G1 cell accumulation and cell death.
21447778 2011 Inherited variants in mitochondrial biogenesis genes may influence epithelial ovarian cancer risk.
21326908 Mitochondrial transcription: how does it end?
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20846394 2010 Effects on mitochondrial transcription of manipulating mTERF protein levels in cultured human HEK293 cells.
20550934 2010 Helix unwinding and base flipping enable human MTERF1 to terminate mitochondrial transcription.
20543826 2010 Human mitochondrial mTERF wraps around DNA through a left-handed superhelical tandem repeat.
More...