Property Summary

NCBI Gene PubMed Count 29
PubMed Score 118.79
PubTator Score 21.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
MELAS syndrome 18 5.37 2.7
Mitral valve stenosis 14 3.019 1.5

Expression

Protein-protein Interaction (1)

Gene RIF (15)

AA Sequence

MQSLSLGQTSISKGLNYLTIMAPGNLWHMRNNFLFGSRCWMTRFSAENIFKSVSFRLFGVKCHNTDSEPL      1 - 70
KNEDLLKNLLTMGVDIDMARKRQPGVFHRMITNEQDLKMFLLSKGASKEVIASIISRYPRAITRTPENLS     71 - 140
KRWDLWRKIVTSDLEIVNILERSPESFFRSNNNLNLENNIKFLYSVGLTRKCLCRLLTNAPRTFSNSLDL    141 - 210
NKQMVEFLQAAGLSLGHNDPADFVRKIIFKNPFILIQSTKRVKANIEFLRSTFNLNSEELLVLICGPGAE    211 - 280
ILDLSNDYARRSYANIKEKLFSLGCTEEEVQKFVLSYPDVIFLAEKKFNDKIDCLMEENISISQIIENPR    281 - 350
VLDSSISTLKSRIKELVNAGCNLSTLNITLLSWSKKRYEAKLKKLSRFA                         351 - 399
//

Text Mined References (29)

PMID Year Title