Property Summary

NCBI Gene PubMed Count 20
Grant Count 8
R01 Count 5
Funding $710,369.67
PubMed Score 38.16
PubTator Score 18.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
esophageal adenocarcinoma 1.300 0.029
glioblastoma 1.200 0.007
group 3 medulloblastoma 1.200 0.001
Pick disease -1.200 0.000
progressive supranuclear palsy -1.100 0.006
ovarian cancer 1.800 0.000

Gene RIF (9)

PMID Text
25361733 Zrf1 is transcriptional regulator of neural fate downstream of Id1 in embryonic stem cells.During embryonic stem cell differentiation, Id1 levels decrease allowing Zrf1 to activate neural genes.
24449271 Zrf1 plays an essential role in neural progenitor cell generation and maintenance
24292673 our data reveal that ZRF1 is a key transcriptional regulator in leukemia progression
22733129 ZRF1 regulates the INK4-ARF locus during cellular proliferation and senescence, and alterations in ZRF1 may contribute to tumorigenesis.
22433847 the majority of AML patients elicited a humoral immune response against the tumor antigen MPP11
21179169 At the onset of differentiation, ZRF1 specifically displaces polycomb-repressive complex 1 (PRC1) from chromatin and facilitates transcriptional activation
20231810 describe a novel epitope derived from the MPP11 antigen that has been recognized by human CD8+ CTL
16002468 MPP11 is localized to the cytosol and with Hsp70L1, forms the mammalian ribosome-associated complex.
15802566 concluded that Mpp11, an ortholog of yeast Zuo, is a ribosome-associated J protein; proposed that in metazoans, ribosome-associated Zuo and Mpp11 orthologs recruit cytosolic Hsc70 to short ribosome-bound nascent chains as they exit the ribosome

AA Sequence

MLLLPSAADGRGTAITHALTSASTLCQVEPVGRWFEAFVKRRNRNASASFQELEDKKELSEESEDEELQL      1 - 70
EEFPMLKTLDPKDWKNQDHYAVLGLGHVRYKATQRQIKAAHKAMVLKHHPDKRKAAGEPIKEGDNDYFTC     71 - 140
ITKAYEMLSDPVKRRAFNSVDPTFDNSVPSKSEAKDNFFEVFTPVFERNSRWSNKKNVPKLGDMNSSFED    141 - 210
VDIFYSFWYNFDSWREFSYLDEEEKEKAECRDERRWIEKQNRATRAQRKKEEMNRIRTLVDNAYSCDPRI    211 - 280
KKFKEEEKAKKEAEKKAKAEAKRKEQEAKEKQRQAELEAARLAKEKEEEEVRQQALLAKKEKDIQKKAIK    281 - 350
KERQKLRNSCKTWNHFSDNEAERVKMMEEVEKLCDRLELASLQCLNETLTSCTKEVGKAALEKQIEEINE    351 - 420
QIRKEKEEAEARMRQASKNTEKSTGGGGNGSKNWSEDDLQLLIKAVNLFPAGTNSRWEVIANYMNIHSSS    421 - 490
GVKRTAKDVIGKAKSLQKLDPHQKDDINKKAFDKFKKEHGVVPQADNATPSERFEGPYTDFTPWTTEEQK    491 - 560
LLEQALKTYPVNTPERWEKIAEAVPGRTKKDCMKRYKELVEMVKAKKAAQEQVLNASRAKK             561 - 621
//

Text Mined References (31)

PMID Year Title
25361733 2015 Direct interaction between Id1 and Zrf1 controls neural differentiation of embryonic stem cells.
24449271 2014 Zrf1 is required to establish and maintain neural progenitor identity.
24292673 2014 ZRF1 controls the retinoic acid pathway and regulates leukemogenic potential in acute myeloid leukemia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22733129 2013 ZRF1 controls oncogene-induced senescence through the INK4-ARF locus.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22433847 2012 M-phase phosphoprotein 11 is a highly immunogenic tumor antigen in patients with acute myeloid leukemia.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...