Property Summary

NCBI Gene PubMed Count 24
PubMed Score 40.60
PubTator Score 18.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
esophageal adenocarcinoma 1.300 2.9e-02
glioblastoma 1.200 6.6e-03
group 3 medulloblastoma 1.200 7.9e-04
malignant mesothelioma 1.300 5.7e-07
ovarian cancer 1.800 4.5e-05
Pick disease -1.200 3.1e-05
progressive supranuclear palsy -1.100 6.3e-03

Gene RIF (13)

AA Sequence

MLLLPSAADGRGTAITHALTSASTLCQVEPVGRWFEAFVKRRNRNASASFQELEDKKELSEESEDEELQL      1 - 70
EEFPMLKTLDPKDWKNQDHYAVLGLGHVRYKATQRQIKAAHKAMVLKHHPDKRKAAGEPIKEGDNDYFTC     71 - 140
ITKAYEMLSDPVKRRAFNSVDPTFDNSVPSKSEAKDNFFEVFTPVFERNSRWSNKKNVPKLGDMNSSFED    141 - 210
VDIFYSFWYNFDSWREFSYLDEEEKEKAECRDERRWIEKQNRATRAQRKKEEMNRIRTLVDNAYSCDPRI    211 - 280
KKFKEEEKAKKEAEKKAKAEAKRKEQEAKEKQRQAELEAARLAKEKEEEEVRQQALLAKKEKDIQKKAIK    281 - 350
KERQKLRNSCKTWNHFSDNEAERVKMMEEVEKLCDRLELASLQCLNETLTSCTKEVGKAALEKQIEEINE    351 - 420
QIRKEKEEAEARMRQASKNTEKSTGGGGNGSKNWSEDDLQLLIKAVNLFPAGTNSRWEVIANYMNIHSSS    421 - 490
GVKRTAKDVIGKAKSLQKLDPHQKDDINKKAFDKFKKEHGVVPQADNATPSERFEGPYTDFTPWTTEEQK    491 - 560
LLEQALKTYPVNTPERWEKIAEAVPGRTKKDCMKRYKELVEMVKAKKAAQEQVLNASRAKK             561 - 621
//

Text Mined References (35)

PMID Year Title