Property Summary

NCBI Gene PubMed Count 47
PubMed Score 12.18
PubTator Score 167.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.500 4.6e-03
astrocytic glioma -1.300 2.5e-03
Astrocytoma, Pilocytic -1.400 5.0e-05
atypical teratoid / rhabdoid tumor -2.300 6.2e-13
ependymoma -1.600 1.9e-03
glioblastoma -1.400 3.8e-06
group 3 medulloblastoma -1.400 2.9e-02
medulloblastoma, large-cell -2.300 4.9e-07
oligodendroglioma -1.200 4.2e-03
osteosarcoma -1.917 1.3e-06
primitive neuroectodermal tumor -1.700 2.0e-04
psoriasis 1.500 3.4e-70

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (30)

AA Sequence

MSRGAGALQRRTTTYLISLTLVKLESVPPPPPSPSAAAVGAPGARGSEPRDPGSPRGAEEPGKKRHERLF      1 - 70
HRQDALWISTSSAGAGGAEPPALSPAPASPARPVSPAPGRRLSLWAAPPGPPLSGGLSPDSKPGGAPSSS     71 - 140
RRPLLSSPSWGGPEPEGRTGGGVPGSSSPHPGTGSRRLKVAPPPPAPKPCKTVTTSGAKAGGGKGAGSRL    141 - 210
SWPESEGKPRVKGSKSSAGTGASVSAAATAAAAGGGGSTASTSGGVGAGAGARGKLSPRKGKSKTLDNSD    211 - 280
LHPGPPAGSPPPLTLPPTPSPATAVTAASAQPPGPAPPITLEPPAPGLKRGREGGRASTRDRKMLKFISG    281 - 350
IFTKSTGGPPGSGPLPGPPSLSSGSGSRELLGAELRASPKAVINSQEWTLSRSIPELRLGVLGDARSGKS    351 - 420
SLIHRFLTGSYQVLEKTESEQYKKEMLVDGQTHLVLIREEAGAPDAKFSGWADAVIFVFSLEDENSFQAV    421 - 490
SRLHGQLSSLRGEGRGGLALALVGTQDRISASSPRVVGDARARALCADMKRCSYYETCATYGLNVDRVFQ    491 - 560
EVAQKVVTLRKQQQLLAACKSLPSSPSHSAASTPVAGQASNGGHTSDYSSSLPSSPNVGHRELRAEAAAV    561 - 630
AGLSTPGSLHRAAKRRTSLFANRRGSDSEKRSLDSRGETTGSGRAIPIKQSFLLKRSGNSLNKEWKKKYV    631 - 700
TLSSNGFLLYHPSINDYIHSTHGKEMDLLRTTVKVPGKRPPRAISAFGPSASINGLVKDMSTVQMGEGLE    701 - 770
ATTPMPSPSPSPSSLQPPPDQTSKHLLKPDRNLARALSTDCTPSGDLSPLSREPPPSPMVKKQRRKKLTT    771 - 840
PSKTEGSAGQAEAKRKMWKLKSFGSLRNIYKAEENFEFLIVSSTGQTWHFEAASFEERDAWVQAIESQIL    841 - 910
ASLQCCESSKVKLRTDSQSEAVAIQAIRNAKGNSICVDCGAPNPTWASLNLGALICIECSGIHRNLGTHL    911 - 980
SRVRSLDLDDWPRELTLVLTAIGNDTANRVWESDTRGRAKPSRDSSREERESWIRAKYEQLLFLAPLSTS    981 - 1050
EEPLGRQLWAAVQAQDVATVLLLLAHARHGPLDTSVEDPQLRSPLHLAAELAHVVITQLLLWYGADVAAR   1051 - 1120
DAQGRTALFYARQAGSQLCADILLQHGCPGEGGSAATTPSAATTPSITATPSPRRRSSAASVGRADAPVA   1121 - 1190
LV                                                                       1191 - 1192
//

Text Mined References (49)

PMID Year Title