Property Summary

NCBI Gene PubMed Count 46
PubMed Score 10.28
PubTator Score 167.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Multiple Sclerosis 498
Disease Target Count P-value
psoriasis 6685 3.39343612459778E-70
ependymoma 2514 1.2286451483662E-20
medulloblastoma 1524 1.32069589250591E-10
atypical teratoid / rhabdoid tumor 4369 4.51957692979235E-10
glioblastoma 5572 1.21987838191371E-8
medulloblastoma, large-cell 6234 1.38878555561106E-7
pilocytic astrocytoma 3086 2.52713398184955E-7
pediatric high grade glioma 2712 4.0239718234815E-7
osteosarcoma 7933 1.28801317370275E-6
primitive neuroectodermal tumor 3031 6.31844544263017E-5
astrocytic glioma 2241 0.00328884938176153
oligodendroglioma 2849 0.0113175013447595
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.800 0.003
ependymoma -2.800 0.000
oligodendroglioma -1.500 0.011
glioblastoma -2.900 0.000
osteosarcoma -1.917 0.000
medulloblastoma -2.900 0.000
atypical teratoid / rhabdoid tumor -3.000 0.000
medulloblastoma, large-cell -3.100 0.000
primitive neuroectodermal tumor -2.300 0.000
pediatric high grade glioma -2.400 0.000
pilocytic astrocytoma -2.200 0.000
psoriasis 1.500 0.000

Synonym

Accession Q99490 A8K9F7 O00578 Q548E0 Q8IWU3 AGAP-2
Symbols PIKE
GGAP2
CENTG1

Gene

PDB

2BMJ   2IWR   2RLO  

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog EggNOG Inparanoid
Cow OMA Inparanoid
Anole lizard OMA Inparanoid

 GWAS Trait (1)

Gene RIF (29)

PMID Text
26977005 Studies showed that overexpression or mutation of PIKE has been observed in a variety of tumors, promoting cancer cell growth, transformation and invasion through AKT signaling or other signaling pathways, such as focal adhesion kinase. [review]
26464646 expression of PLC-gamma1 and PIKE positively correlated with the tumor differentiation of oral squamous cell carcinoma.
26001218 Mutation of Fyn phosphorylation sites on PIKE-A, depletion of Fyn, or pharmacological inhibition of Fyn blunts the association between PIKE-A and AMPK, resulting in loss of its inhibitory effect on AMPK.
25921541 PIKE reduction rescued PI3K-dependent and -independent neuronal defects in fragile X syndrome.
23770988 In this review the CENTG1 gene is amplified in a variety of human cancers which lead to the enhancement of tumor invasion.
23527545 AGAP2 plays a role in the signalling and recycling of beta2-adrenergic receptors.
23438599 Fyn regulates the activity of the adipogenic transcription factor signal transducer and activator of transcription 5a (STAT5a) through enhancing its interaction with the GTPase phosphoinositide 3-kinase enhancer A (PIKE-A).
22389719 The presence of heterogeneous missense mutations of GGAP2 in prostate cancer was associated with aggressive clinical behavior.
22349826 PIKE is highly expressed in human squamous cell carcinoma and has a critical role in EGF-induced squamous cell carcinoma proliferation.
21847098 PIKE is a critical factor in controlling synaptic AMPA receptor insertion.
More...

AA Sequence

MSRGAGALQRRTTTYLISLTLVKLESVPPPPPSPSAAAVGAPGARGSEPRDPGSPRGAEEPGKKRHERLF      1 - 70
HRQDALWISTSSAGAGGAEPPALSPAPASPARPVSPAPGRRLSLWAAPPGPPLSGGLSPDSKPGGAPSSS     71 - 140
RRPLLSSPSWGGPEPEGRTGGGVPGSSSPHPGTGSRRLKVAPPPPAPKPCKTVTTSGAKAGGGKGAGSRL    141 - 210
SWPESEGKPRVKGSKSSAGTGASVSAAATAAAAGGGGSTASTSGGVGAGAGARGKLSPRKGKSKTLDNSD    211 - 280
LHPGPPAGSPPPLTLPPTPSPATAVTAASAQPPGPAPPITLEPPAPGLKRGREGGRASTRDRKMLKFISG    281 - 350
IFTKSTGGPPGSGPLPGPPSLSSGSGSRELLGAELRASPKAVINSQEWTLSRSIPELRLGVLGDARSGKS    351 - 420
SLIHRFLTGSYQVLEKTESEQYKKEMLVDGQTHLVLIREEAGAPDAKFSGWADAVIFVFSLEDENSFQAV    421 - 490
SRLHGQLSSLRGEGRGGLALALVGTQDRISASSPRVVGDARARALCADMKRCSYYETCATYGLNVDRVFQ    491 - 560
EVAQKVVTLRKQQQLLAACKSLPSSPSHSAASTPVAGQASNGGHTSDYSSSLPSSPNVGHRELRAEAAAV    561 - 630
AGLSTPGSLHRAAKRRTSLFANRRGSDSEKRSLDSRGETTGSGRAIPIKQSFLLKRSGNSLNKEWKKKYV    631 - 700
TLSSNGFLLYHPSINDYIHSTHGKEMDLLRTTVKVPGKRPPRAISAFGPSASINGLVKDMSTVQMGEGLE    701 - 770
ATTPMPSPSPSPSSLQPPPDQTSKHLLKPDRNLARALSTDCTPSGDLSPLSREPPPSPMVKKQRRKKLTT    771 - 840
PSKTEGSAGQAEAKRKMWKLKSFGSLRNIYKAEENFEFLIVSSTGQTWHFEAASFEERDAWVQAIESQIL    841 - 910
ASLQCCESSKVKLRTDSQSEAVAIQAIRNAKGNSICVDCGAPNPTWASLNLGALICIECSGIHRNLGTHL    911 - 980
SRVRSLDLDDWPRELTLVLTAIGNDTANRVWESDTRGRAKPSRDSSREERESWIRAKYEQLLFLAPLSTS    981 - 1050
EEPLGRQLWAAVQAQDVATVLLLLAHARHGPLDTSVEDPQLRSPLHLAAELAHVVITQLLLWYGADVAAR   1051 - 1120
DAQGRTALFYARQAGSQLCADILLQHGCPGEGGSAATTPSAATTPSITATPSPRRRSSAASVGRADAPVA   1121 - 1190
LV                                                                       1191 - 1192
//

Text Mined References (48)

PMID Year Title
26977005 2016 Phosphoinositide-3-Kinase Enhancers, PIKEs: Their Biological Functions and Roles in Cancer.
26464646 2015 Reduced expression of E-cadherin and p120-catenin and elevated expression of PLC-?1 and PIKE are associated with aggressiveness of oral squamous cell carcinoma.
26001218 2016 Fyn-phosphorylated PIKE-A binds and inhibits AMPK signaling, blocking its tumor suppressive activity.
25921541 2015 Increased expression of the PI3K enhancer PIKE mediates deficits in synaptic plasticity and behavior in fragile X syndrome.
23770988 2013 The roles of PIKE in tumorigenesis.
23527545 2013 The Arf GAP AGAP2 interacts with ?-arrestin2 and regulates ?2-adrenergic receptor recycling and ERK activation.
23438599 2013 Fyn regulates adipogenesis by promoting PIKE-A/STAT5a interaction.
22389719 2012 Frequent heterogeneous missense mutations of GGAP2 in prostate cancer: implications for tumor biology, clonality and mutation analysis.
22349826 2012 PIKE mediates EGFR proliferative signaling in squamous cell carcinoma cells.
21847098 2011 PIKE-mediated PI3-kinase activity is required for AMPA receptor surface expression.
More...