Property Summary

NCBI Gene PubMed Count 46
Grant Count 3
Funding $144,018
PubMed Score 10.28
PubTator Score 167.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.800 0.003
ependymoma -2.800 0.000
oligodendroglioma -1.500 0.011
glioblastoma -2.900 0.000
osteosarcoma -1.917 0.000
medulloblastoma -2.900 0.000
atypical teratoid / rhabdoid tumor -3.000 0.000
medulloblastoma, large-cell -3.100 0.000
primitive neuroectodermal tumor -2.300 0.000
pediatric high grade glioma -2.400 0.000
pilocytic astrocytoma -2.200 0.000
psoriasis 1.500 0.000

Synonym

Accession Q99490 A8K9F7 O00578 Q548E0 Q8IWU3 AGAP-2
Symbols PIKE
GGAP2
CENTG1

Gene

PDB

2BMJ   2IWR   2RLO  

Gene RIF (29)

PMID Text
26977005 Studies showed that overexpression or mutation of PIKE has been observed in a variety of tumors, promoting cancer cell growth, transformation and invasion through AKT signaling or other signaling pathways, such as focal adhesion kinase. [review]
26464646 expression of PLC-gamma1 and PIKE positively correlated with the tumor differentiation of oral squamous cell carcinoma.
26001218 Mutation of Fyn phosphorylation sites on PIKE-A, depletion of Fyn, or pharmacological inhibition of Fyn blunts the association between PIKE-A and AMPK, resulting in loss of its inhibitory effect on AMPK.
25921541 PIKE reduction rescued PI3K-dependent and -independent neuronal defects in fragile X syndrome.
23770988 In this review the CENTG1 gene is amplified in a variety of human cancers which lead to the enhancement of tumor invasion.
23527545 AGAP2 plays a role in the signalling and recycling of beta2-adrenergic receptors.
23438599 Fyn regulates the activity of the adipogenic transcription factor signal transducer and activator of transcription 5a (STAT5a) through enhancing its interaction with the GTPase phosphoinositide 3-kinase enhancer A (PIKE-A).
22389719 The presence of heterogeneous missense mutations of GGAP2 in prostate cancer was associated with aggressive clinical behavior.
22349826 PIKE is highly expressed in human squamous cell carcinoma and has a critical role in EGF-induced squamous cell carcinoma proliferation.
21847098 PIKE is a critical factor in controlling synaptic AMPA receptor insertion.
More...

AA Sequence

MSRGAGALQRRTTTYLISLTLVKLESVPPPPPSPSAAAVGAPGARGSEPRDPGSPRGAEEPGKKRHERLF      1 - 70
HRQDALWISTSSAGAGGAEPPALSPAPASPARPVSPAPGRRLSLWAAPPGPPLSGGLSPDSKPGGAPSSS     71 - 140
RRPLLSSPSWGGPEPEGRTGGGVPGSSSPHPGTGSRRLKVAPPPPAPKPCKTVTTSGAKAGGGKGAGSRL    141 - 210
SWPESEGKPRVKGSKSSAGTGASVSAAATAAAAGGGGSTASTSGGVGAGAGARGKLSPRKGKSKTLDNSD    211 - 280
LHPGPPAGSPPPLTLPPTPSPATAVTAASAQPPGPAPPITLEPPAPGLKRGREGGRASTRDRKMLKFISG    281 - 350
IFTKSTGGPPGSGPLPGPPSLSSGSGSRELLGAELRASPKAVINSQEWTLSRSIPELRLGVLGDARSGKS    351 - 420
SLIHRFLTGSYQVLEKTESEQYKKEMLVDGQTHLVLIREEAGAPDAKFSGWADAVIFVFSLEDENSFQAV    421 - 490
SRLHGQLSSLRGEGRGGLALALVGTQDRISASSPRVVGDARARALCADMKRCSYYETCATYGLNVDRVFQ    491 - 560
EVAQKVVTLRKQQQLLAACKSLPSSPSHSAASTPVAGQASNGGHTSDYSSSLPSSPNVGHRELRAEAAAV    561 - 630
AGLSTPGSLHRAAKRRTSLFANRRGSDSEKRSLDSRGETTGSGRAIPIKQSFLLKRSGNSLNKEWKKKYV    631 - 700
TLSSNGFLLYHPSINDYIHSTHGKEMDLLRTTVKVPGKRPPRAISAFGPSASINGLVKDMSTVQMGEGLE    701 - 770
ATTPMPSPSPSPSSLQPPPDQTSKHLLKPDRNLARALSTDCTPSGDLSPLSREPPPSPMVKKQRRKKLTT    771 - 840
PSKTEGSAGQAEAKRKMWKLKSFGSLRNIYKAEENFEFLIVSSTGQTWHFEAASFEERDAWVQAIESQIL    841 - 910
ASLQCCESSKVKLRTDSQSEAVAIQAIRNAKGNSICVDCGAPNPTWASLNLGALICIECSGIHRNLGTHL    911 - 980
SRVRSLDLDDWPRELTLVLTAIGNDTANRVWESDTRGRAKPSRDSSREERESWIRAKYEQLLFLAPLSTS    981 - 1050
EEPLGRQLWAAVQAQDVATVLLLLAHARHGPLDTSVEDPQLRSPLHLAAELAHVVITQLLLWYGADVAAR   1051 - 1120
DAQGRTALFYARQAGSQLCADILLQHGCPGEGGSAATTPSAATTPSITATPSPRRRSSAASVGRADAPVA   1121 - 1190
LV                                                                       1191 - 1192
//

Text Mined References (48)

PMID Year Title
26977005 2016 Phosphoinositide-3-Kinase Enhancers, PIKEs: Their Biological Functions and Roles in Cancer.
26464646 2015 Reduced expression of E-cadherin and p120-catenin and elevated expression of PLC-?1 and PIKE are associated with aggressiveness of oral squamous cell carcinoma.
26001218 2016 Fyn-phosphorylated PIKE-A binds and inhibits AMPK signaling, blocking its tumor suppressive activity.
25921541 2015 Increased expression of the PI3K enhancer PIKE mediates deficits in synaptic plasticity and behavior in fragile X syndrome.
23770988 2013 The roles of PIKE in tumorigenesis.
23527545 2013 The Arf GAP AGAP2 interacts with ?-arrestin2 and regulates ?2-adrenergic receptor recycling and ERK activation.
23438599 2013 Fyn regulates adipogenesis by promoting PIKE-A/STAT5a interaction.
22389719 2012 Frequent heterogeneous missense mutations of GGAP2 in prostate cancer: implications for tumor biology, clonality and mutation analysis.
22349826 2012 PIKE mediates EGFR proliferative signaling in squamous cell carcinoma cells.
21847098 2011 PIKE-mediated PI3-kinase activity is required for AMPA receptor surface expression.
More...