Property Summary

NCBI Gene PubMed Count 7
Grant Count 9
R01 Count 9
Funding $791,429
PubMed Score 22.45
PubTator Score 6.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
breast carcinoma 1,614
ovarian cancer 8,484

Expression

  Differential Expression (2)

Disease log2 FC p
breast carcinoma 1.100 0.012
ovarian cancer 1.100 0.002

Gene RIF (5)

PMID Text
26286023 Data indicate a function for stromal cell-derived factor 2 (SDF2) as a component of the heat-shock proteins 90-endothelial nitric oxide synthase (Hsp90-eNOS) complex that is critical for signal transduction in endothelial cells.
22190034 HIV-1 gp120 is identified to have a physical interaction with stromal cell-derived factor 2 (SDF2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22190034 HIV-1 gp120 is identified to have a physical interaction with stromal cell-derived factor 2 (SDF2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
19513569 SDF-2, SDF-4 and SDF-5 are expressed in mammary tissues and cells and that a reduced level of SDF-2 and SDF-4 are associated with a poor clinical outcome.
19479237 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAVVPLLLLGGLWSAVGASSLGVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYW      1 - 70
RIRGKSATVCERGTPIKCGQPIRLTHVNTGRNLHSHHFTSPLSGNQEVSAFGEEGEGDYLDDWTVLCNGP     71 - 140
YWVRDGEVRFKHSSTEVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEGIFMKPSELLKAEAHHAE    141 - 210
L//

Text Mined References (9)

PMID Year Title
26286023 2015 Stromal cell-derived factor 2 is critical for Hsp90-dependent eNOS activation.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21269460 2011 Initial characterization of the human central proteome.
19513569 2009 Transcript analyses of stromal cell derived factors (SDFs): SDF-2, SDF-4 and SDF-5 reveal a different pattern of expression and prognostic association in human breast cancer.
19479237 2009 Phenotype-genotype interactions on renal function in type 2 diabetes: an analysis using structural equation modelling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107413 2002 Expressed sequence tag analysis of adult human lens for the NEIBank Project: over 2000 non-redundant transcripts, novel genes and splice variants.
8918255 1996 Isolation and characterization of a novel secretory protein, stromal cell-derived factor-2 (SDF-2) using the signal sequence trap method.