Property Summary

NCBI Gene PubMed Count 19
Grant Count 21
R01 Count 17
Funding $1,831,729.09
PubMed Score 12.62
PubTator Score 12.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 1.300 0.000

Gene RIF (9)

PMID Text
22050566 c-Myc expression is reduced in pterygium compared with normal conjunctiva.
20562918 miR-22 acts as a tumor suppressor through direct repression of MYCBP expression and subsequent reduction of oncogenic c-Myc activities.
20544396 Suppression of telomerase activity mediated by PinX1 is involved in the Mad1/c-Myc pathway.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17595061 An important role for MBP-1 in the altered cell proliferation and energy utilization that occur in response to an altered glucose concentration.
16866877 AMY-1 coordinates ADP-Ribosylation Factors-mediated membrane trafficking and signaling pathways.
12414807 interacts with S-AKAP84 and AKAP95 in the cytoplasm and the nucleus, respectively, and inhibits enzyme acdtivity by preventing binding of its catalytic subunit to A-kinase-anchoring protein (AKAP) complex
12223483 identified a novel AMY-1-binding protein, AAT-1, and determied its expression profiles, genes, and cellular localization; results showed that AAT-1 was specifically expressed in the testis throughout spermatogenesis and was also present in mature sperm
11483602 AMY-1 was localized in the mitochondria of HeLa and sperm in association with AKAP149 and S-AKAP84, respectively. These results suggest that AMY-1 plays a role in spermatogenesis

AA Sequence

MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELA      1 - 70
EMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE                                          71 - 103
//

Text Mined References (22)

PMID Year Title
22050566 2011 Downregulation of c-Myc in pterygium and cultured pterygial cells.
20562918 2010 Tumor-suppressive microRNA-22 inhibits the transcription of E-box-containing c-Myc target genes by silencing c-Myc binding protein.
20544396 2010 PinX1 inhibits telomerase activity in gastric cancer cells through Mad1/c-Myc pathway.
20500816 2010 Genomic profiling of tumor initiating prostatospheres.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17595061 2007 c-myc promoter binding protein regulates the cellular response to an altered glucose concentration.
16866877 2006 AMY-1 (associate of Myc-1) localization to the trans-Golgi network through interacting with BIG2, a guanine-nucleotide exchange factor for ADP-ribosylation factors.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...