Property Summary

NCBI Gene PubMed Count 19
PubMed Score 12.62
PubTator Score 12.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Adenoid Cystic Carcinoma 99
Disease Target Count P-value
posterior fossa group B ependymoma 1530 1.10487607607047E-7

Expression

  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 1.300 0.000

Synonym

Accession Q99417 B2R4N0 Q5TA64 Q96HE2
Symbols AMY-1

Gene

PDB

2YY0  

  Ortholog (7)

Species Source
Mouse EggNOG Inparanoid
Rat EggNOG Inparanoid
Dog EggNOG Inparanoid
Cow EggNOG Inparanoid
Platypus EggNOG Inparanoid
Anole lizard EggNOG Inparanoid
Xenopus EggNOG Inparanoid

Gene RIF (9)

PMID Text
22050566 c-Myc expression is reduced in pterygium compared with normal conjunctiva.
20562918 miR-22 acts as a tumor suppressor through direct repression of MYCBP expression and subsequent reduction of oncogenic c-Myc activities.
20544396 Suppression of telomerase activity mediated by PinX1 is involved in the Mad1/c-Myc pathway.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17595061 An important role for MBP-1 in the altered cell proliferation and energy utilization that occur in response to an altered glucose concentration.
16866877 AMY-1 coordinates ADP-Ribosylation Factors-mediated membrane trafficking and signaling pathways.
12414807 interacts with S-AKAP84 and AKAP95 in the cytoplasm and the nucleus, respectively, and inhibits enzyme acdtivity by preventing binding of its catalytic subunit to A-kinase-anchoring protein (AKAP) complex
12223483 identified a novel AMY-1-binding protein, AAT-1, and determied its expression profiles, genes, and cellular localization; results showed that AAT-1 was specifically expressed in the testis throughout spermatogenesis and was also present in mature sperm
11483602 AMY-1 was localized in the mitochondria of HeLa and sperm in association with AKAP149 and S-AKAP84, respectively. These results suggest that AMY-1 plays a role in spermatogenesis

AA Sequence

MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELA      1 - 70
EMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE                                          71 - 103
//

Text Mined References (22)

PMID Year Title
22050566 2011 Downregulation of c-Myc in pterygium and cultured pterygial cells.
20562918 2010 Tumor-suppressive microRNA-22 inhibits the transcription of E-box-containing c-Myc target genes by silencing c-Myc binding protein.
20544396 2010 PinX1 inhibits telomerase activity in gastric cancer cells through Mad1/c-Myc pathway.
20500816 2010 Genomic profiling of tumor initiating prostatospheres.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17595061 2007 c-myc promoter binding protein regulates the cellular response to an altered glucose concentration.
16866877 2006 AMY-1 (associate of Myc-1) localization to the trans-Golgi network through interacting with BIG2, a guanine-nucleotide exchange factor for ADP-ribosylation factors.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
More...