Property Summary

NCBI Gene PubMed Count 19
PubMed Score 14.23
PubTator Score 12.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma, Adenoid Cystic 99 0.0 0.0
Disease Target Count
Adenoid Cystic Carcinoma 99
Disease Target Count P-value
posterior fossa group B ependymoma 416 1.1e-07

Expression

  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 1.300 1.1e-07

Gene RIF (9)

AA Sequence

MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELA      1 - 70
EMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE                                          71 - 103
//

Text Mined References (22)

PMID Year Title