Property Summary

NCBI Gene PubMed Count 10
Grant Count 18
R01 Count 9
Funding $1,387,528.65
PubMed Score 39.96
PubTator Score 44.42

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

PMID Text
26018249 expressed in osteoblasts and osteoclasts
18433898 Dual site-disrupted GPA2 and the GPB5 mutant were not expressed in either the conditioned medium or cell lysate.
17363077 Sudy illustrated that GPA2 is positively regulated by isl-1, suggesting that this protein associates with endocrine systems including the pituitary and pancreas.
16376481 cloning and functional analysis of the promoter of the thyrostimulin A2 subunit
15890769 GPA2, and another beta-subunit, GPB5, in human, are capable of forming heterodimers to activate TSH receptors.
12089349 identification and characterization of GPA2 genes
11809971 capable of mediating the action of relaxin through an adenosine 3',5'-monophosphate (cAMP)-dependent pathway

AA Sequence

MPMASPQTLVLYLLVLAVTEAWGQEAVIPGCHLHPFNVTVRSDRQGTCQGSHVAQACVGHCESSAFPSRY      1 - 70
SVLVASGYRHNITSVSQCCTISGLKKVKVQLQCVGSRREELEIFTARACQCDMCRLSRY                71 - 129
//

Text Mined References (10)

PMID Year Title
26018249 2015 Thyrostimulin Regulates Osteoblastic Bone Formation During Early Skeletal Development.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
18433898 2008 Biochemical roles of the oligosaccharide chains in thyrostimulin, a heterodimeric hormone of glycoprotein hormone subunits alpha 2 (GPA2) and beta 5 (GPB5).
17363077 2007 The LIM domain homeobox gene isl-1 is a positive regulator of glycoprotein alpha 2 (GPA2), a subunit of thyrostimulin.
16376481 2005 Promoter cloning and characterisation of the transcriptional regulation of the human thyrostimulin A2 subunit.
15890769 2005 Heterodimeric fly glycoprotein hormone-alpha2 (GPA2) and glycoprotein hormone-beta5 (GPB5) activate fly leucine-rich repeat-containing G protein-coupled receptor-1 (DLGR1) and stimulation of human thyrotropin receptors by chimeric fly GPA2 and human GPB5.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12089349 2002 Evolution of glycoprotein hormone subunit genes in bilateral metazoa: identification of two novel human glycoprotein hormone subunit family genes, GPA2 and GPB5.
12045258 2002 Thyrostimulin, a heterodimer of two new human glycoprotein hormone subunits, activates the thyroid-stimulating hormone receptor.