Property Summary

NCBI Gene PubMed Count 10
PubMed Score 43.02
PubTator Score 44.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Synonym

Accession Q96T91 Q52LE2
Symbols A2
GPA2
ZSIG51

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (7)

AA Sequence

MPMASPQTLVLYLLVLAVTEAWGQEAVIPGCHLHPFNVTVRSDRQGTCQGSHVAQACVGHCESSAFPSRY      1 - 70
SVLVASGYRHNITSVSQCCTISGLKKVKVQLQCVGSRREELEIFTARACQCDMCRLSRY                71 - 129
//

Text Mined References (10)

PMID Year Title