Property Summary

NCBI Gene PubMed Count 30
Grant Count 27
R01 Count 12
Funding $2,372,508.05
PubMed Score 40.58
PubTator Score 19.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.520 0.000
ovarian cancer 1.300 0.000

Gene RIF (15)

PMID Text
25892874 Suggest that MMS19 may be a potential new predictor of metastasis and chemoradiotherapy response in esophageal squamous cell carcinoma.
23886164 MMS19L polymorphisms are associated with response to chemotherapy in osteosarcoma.
23679317 Single nucleotide polymorphisms in the MMS19L gene is associated with bone malignant tumors.
23632208 Polymorphisms in ERCC1, codon-118 and MMS19 genes are not associated with clinical response to platinum or survival.
23585563 MMS19 interacts with target proteins. MIP18 has a role to bridge MMS19 and CIAO1. CIAO1 also binds IOP1.
23150669 The mammalian proteins MMS19, MIP18, and ANT2 are involved in cytoplasmic iron-sulfur cluster protein assembly.
22678362 identified MMS19 as a member of the cytosolic iron-sulfur protein assembly (CIA) machinery; MMS19 functions as part of the CIA targeting complex that interacts with and facilitates iron-sulfur cluster insertion into apoproteins involved in methionine biosynthesis, DNA replication, DNA repair, and telomere maintenance
22678361 study demonstrates MMS19 forms a complex with the cytoplasmic Fe-S assembly (CIA) proteins CIAO1, IOP1 and MIP18; cytoplasmic MMS19 also binds to multiple nuclear Fe-S proteins involved in DNA metabolism; propose that MMS19 functions as a platform to facilitate Fe-S cluster transfer to proteins critical for DNA replication and repair
20797633 Results indicate that the MMS19-XPD protein complex is required for proper chromosome segregation, an abnormality of which could contribute to the pathogenesis in some cases of xeroderma pigmentosum.
20522537 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAAAAAVEAAAPMGALWGLVHDFVVGQQEGPADQVAADVKSGNYTVLQVVEALGSSLENPEPRTRARAIQ      1 - 70
LLSQVLLHCHTLLLEKEVVHLILFYENRLKDHHLVIPSVLQGLKALSLCVALPPGLAVSVLKAIFQEVHV     71 - 140
QSLPQVDRHTVYNIITNFMRTREEELKSLGADFTFGFIQVMDGEKDPRNLLVAFRIVHDLISRDYSLGPF    141 - 210
VEELFEVTSCYFPIDFTPPPNDPHGIQREDLILSLRAVLASTPRFAEFLLPLLIEKVDSEVLSAKLDSLQ    211 - 280
TLNACCAVYGQKELKDFLPSLWASIRREVFQTASERVEAEGLAALHSLTACLSRSVLRADAEDLLDSFLS    281 - 350
NILQDCRHHLCEPDMKLVWPSAKLLQAAAGASARACDSVTSNVLPLLLEQFHKHSQSSQRRTILEMLLGF    351 - 420
LKLQQKWSYEDKDQRPLNGFKDQLCSLVFMALTDPSTQLQLVGIRTLTVLGAQPDLLSYEDLELAVGHLY    421 - 490
RLSFLKEDSQSCRVAALEASGTLAALYPVAFSSHLVPKLAEELRVGESNLTNGDEPTQCSRHLCCLQALS    491 - 560
AVSTHPSIVKETLPLLLQHLWQVNRGNMVAQSSDVIAVCQSLRQMAEKCQQDPESCWYFHQTAIPCLLAL    561 - 630
AVQASMPEKEPSVLRKVLLEDEVLAAMVSVIGTATTHLSPELAAQSVTHIVPLFLDGNVSFLPENSFPSR    631 - 700
FQPFQDGSSGQRRLIALLMAFVCSLPRNVEIPQLNQLMRELLELSCCHSCPFSSTAAAKCFAGLLNKHPA    701 - 770
GQQLDEFLQLAVDKVEAGLGSGPCRSQAFTLLLWVTKALVLRYHPLSSCLTARLMGLLSDPELGPAAADG    771 - 840
FSLLMSDCTDVLTRAGHAEVRIMFRQRFFTDNVPALVQGFHAAPQDVKPNYLKGLSHVLNRLPKPVLLPE    841 - 910
LPTLLSLLLEALSCPDCVVQLSTLSCLQPLLLEAPQVMSLHVDTLVTKFLNLSSSPSMAVRIAALQCMHA    911 - 980
LTRLPTPVLLPYKPQVIRALAKPLDDKKRLVRKEAVSARGEWFLLGSPGS                        981 - 1030
//

Text Mined References (35)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25892874 2015 Methyl-methanesulfonate sensitivity 19 expression is associated with metastasis and chemoradiotherapy response in esophageal cancer.
25416956 2014 A proteome-scale map of the human interactome network.
23886164 2013 Predictive impact of common variations in DNA repair genes on clinical outcome of osteosarcoma.
23679317 2013 Single nucleotide polymorphisms in the NER pathway and clinical outcome of patients with bone malignant tumors.
23632208 2013 The role of single nucleotide polymorphisms of the ERCC1 and MMS19 genes in predicting platinum-sensitivity, progression-free and overall survival in advanced epithelial ovarian cancer.
23585563 2013 IOP1 protein is an external component of the human cytosolic iron-sulfur cluster assembly (CIA) machinery and functions in the MMS19 protein-dependent CIA pathway.
23150669 2012 The mammalian proteins MMS19, MIP18, and ANT2 are involved in cytoplasmic iron-sulfur cluster protein assembly.
22678362 2012 MMS19 assembles iron-sulfur proteins required for DNA metabolism and genomic integrity.
22678361 2012 MMS19 links cytoplasmic iron-sulfur cluster assembly to DNA metabolism.
More...