Property Summary

NCBI Gene PubMed Count 14
PubMed Score 18.88
PubTator Score 9.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -3.380 0.000
group 4 medulloblastoma 1.500 0.000
ovarian cancer -1.700 0.000

Synonym

Accession Q96T66 B3KVR6 D3DNF2 D3DNF3 Q8N4G1 NMN/NaMN adenylyltransferase 3
Symbols PNAT3
FKSG76
PNAT-3

Gene

PANTHER Protein Class (2)

PDB

1NUP   1NUQ   1NUR   1NUS   1NUT   1NUU  

Gene RIF (5)

PMID Text
24155910 NMNAT3 is absent in mitochondria in human cells, and, akin to plants and yeast, cytosolic NAD maintains the mitochondrial NAD pool.
20457531 Red blood cells represent the first human cell type with a remarkable predominance of NMNAT3 over NMNAT1; NMNAT2 is absent.
20388704 analysis of isoform-specific targeting and interaction domains in human nicotinamide mononucleotide adenylyltransferases
17402747 NMN binds before ATP with the mitochondrial isozyme NMNAT3. Only NMNAT3 utilizes ITP efficiently in place of ATP, and NMNH conversion to NADH by NMNAT1 and NMNAT3 occurs at similar rates.
16118205 NMNAT1 is a nuclear protein, whereas NMNAT2 and -3 are localized to the Golgi complex and the mitochondria

AA Sequence

MKSRIPVVLLACGSFNPITNMHLRMFEVARDHLHQTGMYQVIQGIISPVNDTYGKKDLAASHHRVAMARL      1 - 70
ALQTSDWIRVDPWESEQAQWMETVKVLRHHHSKLLRSPPQMEGPDHGKALFSTPAAVPELKLLCGADVLK     71 - 140
TFQTPNLWKDAHIQEIVEKFGLVCVGRVGHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALG    141 - 210
QGQSVKYLIPDAVITYIKDHGLYTKGSTWKGKSTQSTEGKTS                                211 - 252
//

Text Mined References (17)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24155910 2013 Insight into molecular and functional properties of NMNAT3 reveals new hints of NAD homeostasis within human mitochondria.
20954240 2010 Homology modeling and deletion mutants of human nicotinamide mononucleotide adenylyltransferase isozyme 2: new insights on structure and function relationship.
20457531 2010 Unique expression pattern of human nicotinamide mononucleotide adenylyltransferase isozymes in red blood cells.
20388704 2010 Isoform-specific targeting and interaction domains in human nicotinamide mononucleotide adenylyltransferases.
20117162 2010 Axon degeneration: Mechanisms and implications of a distinct program from cell death.
19448972 2009 Nicotinamide/nicotinic acid mononucleotide adenylyltransferase, new insights into an ancient enzyme.
18344983 2008 NAD synthase NMNAT acts as a chaperone to protect against neurodegeneration.
17402747 2007 Initial-rate kinetics of human NMN-adenylyltransferases: substrate and metal ion specificity, inhibition by products and multisubstrate analogues, and isozyme contributions to NAD+ biosynthesis.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
More...