Property Summary

NCBI Gene PubMed Count 14
PubMed Score 20.10
PubTator Score 9.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Polycystic ovary syndrome 360 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 3.7e-08
ovarian cancer 8520 5.0e-08
group 3 medulloblastoma 4104 1.0e-03
Disease Target Count Z-score Confidence
Agoraphobia 21 3.105 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.100 1.0e-03
osteosarcoma -3.380 3.7e-08
ovarian cancer -1.700 5.0e-08

Protein-protein Interaction (2)

Gene RIF (5)

AA Sequence

MKSRIPVVLLACGSFNPITNMHLRMFEVARDHLHQTGMYQVIQGIISPVNDTYGKKDLAASHHRVAMARL      1 - 70
ALQTSDWIRVDPWESEQAQWMETVKVLRHHHSKLLRSPPQMEGPDHGKALFSTPAAVPELKLLCGADVLK     71 - 140
TFQTPNLWKDAHIQEIVEKFGLVCVGRVGHDPKGYIAESPILRMHQHNIHLAKEPVQNEISATYIRRALG    141 - 210
QGQSVKYLIPDAVITYIKDHGLYTKGSTWKGKSTQSTEGKTS                                211 - 252
//

Text Mined References (17)

PMID Year Title