Property Summary

NCBI Gene PubMed Count 50
PubMed Score 59.82
PubTator Score 96.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
tuberculosis 2010 2.0e-08
psoriasis 6694 1.3e-05
ovarian cancer 8520 5.6e-05
osteosarcoma 7950 9.9e-04
Disease Target Count Z-score Confidence
Intellectual disability 1016 0.0 4.0
Neurodegenerative disease 414 0.0 4.0
Disease Target Count Z-score Confidence
Apraxia 26 4.365 2.2
Ataxia with oculomotor apraxia type 1 5 3.285 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.381 9.9e-04
ovarian cancer 1.800 5.6e-05
psoriasis 2.100 1.3e-05
tuberculosis 1.500 2.0e-08

Protein-protein Interaction (2)

Gene RIF (31)

AA Sequence

MGEVEAPGRLWLESPPGGAPPIFLPSDGQALVLGRGPLTQVTDRKCSRTQVELVADPETRTVAVKQLGVN      1 - 70
PSTTGTQELKPGLEGSLGVGDTLYLVNGLHPLTLRWEETRTPESQPDTPPGTPLVSQDEKRDAELPKKRM     71 - 140
RKSNPGWENLEKLLVFTAAGVKPQGKVAGFDLDGTLITTRSGKVFPTGPSDWRILYPEIPRKLRELEAEG    141 - 210
YKLVIFTNQMSIGRGKLPAEEFKAKVEAVVEKLGVPFQVLVATHAGLYRKPVTGMWDHLQEQANDGTPIS    211 - 280
IGDSIFVGDAAGRPANWAPGRKKKDFSCADRLFALNLGLPFATPEEFFLKWPAAGFELPAFDPRTVSRSG    281 - 350
PLCLPESRALLSASPEVVVAVGFPGAGKSTFLKKHLVSAGYVHVNRDTLGSWQRCVTTCETALKQGKRVA    351 - 420
IDNTNPDAASRARYVQCARAAGVPCRCFLFTATLEQARHNNRFREMTDSSHIPVSDMVMYGYRKQFEAPT    421 - 490
LAEGFSAILEIPFRLWVEPRLGRLYCQFSEG                                           491 - 521
//

Text Mined References (58)

PMID Year Title