Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.60
PubTator Score 5.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 2.8e-06
pancreatic cancer 2398 1.6e-04
pancreatic carcinoma 562 1.6e-04
psoriasis 6694 2.7e-04
astrocytoma 1146 2.1e-03
glioblastoma 5792 3.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Eating disorder 26 0.0 1.2

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytoma 1.600 2.1e-03
glioblastoma 1.100 3.5e-02
ovarian cancer -1.300 2.8e-06
pancreatic cancer 1.100 1.6e-04
pancreatic carcinoma 1.100 1.6e-04
psoriasis 1.500 2.7e-04

Gene RIF (4)

AA Sequence

MADREGGCAAGRGRELEPELEPGPGPGSALEPGEEFEIVDRSQLPGPGDLRSATRPRAAEGWSAPILTLA      1 - 70
RRATGNLSASCGSALRAAAGLGGGDSGDGTARAASKCQMMEERANLMHMMKLSIKVLLQSALSLGRSLDA     71 - 140
DHAPLQQFFVVMEHCLKHGLKVKKSFIGQNKSFFGPLELVEKLCPEASDIATSVRNLPELKTAVGRGRAW    141 - 210
LYLALMQKKLADYLKVLIDNKHLLSEFYEPEALMMEEEGMVIVGLLVGLNVLDANLCLKGEDLDSQVGVI    211 - 280
DFSLYLKDVQDLDGGKEHERITDVLDQKNYVEELNRHLSCTVGDLQTKIDGLEKTNSKLQEELSAATDRI    281 - 350
CSLQEEQQQLREQNELIRERSEKSVEITKQDTKVELETYKQTRQGLDEMYSDVWKQLKEEKKVRLELEKE    351 - 420
LELQIGMKTEMEIAMKLLEKDTHEKQDTLVALRQQLEEVKAINLQMFHKAQNAESSLQQKNEAITSFEGK    421 - 490
TNQVMSSMKQMEERLQHSERARQGAEERSHKLQQELGGRIGALQLQLSQLHEQCSSLEKELKSEKEQRQA    491 - 560
LQRELQHEKDTSSLLRMELQQVEGLKKELRELQDEKAELQKICEEQEQALQEMGLHLSQSKLKMEDIKEV    561 - 630
NQALKGHAWLKDDEATHCRQCEKEFSISRRKHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDSCHTLLL    631 - 700
QRCSSTAS                                                                  701 - 708
//

Text Mined References (19)

PMID Year Title