Property Summary

NCBI Gene PubMed Count 13
Grant Count 1
R01 Count 1
Funding $194,831
PubMed Score 5.48
PubTator Score 5.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
pancreatic cancer 1.100 0.000
psoriasis 1.500 0.000
astrocytoma 1.600 0.002
glioblastoma 1.100 0.035
pancreatic carcinoma 1.100 0.000
ovarian cancer 1.400 0.000

Synonym

Accession Q96T51 Q59FF3 Q71S93 Q9H6I3
Symbols RABIP4
ZFYVE12

Gene

PANTHER Protein Class (1)

 Grant Application (1)

PDB

2YQM   2YW8  

Gene RIF (3)

PMID Text
23144738 Data indicate that RUN and FYVE domain protein Rabip4'(RUFY1) interacts specifically and directly with adaptor protein complex AP-3.
20534812 These findings suggest that Rab14 and Rab4 act sequentially, together with RUFY1.
11877430 interaction with tyrosine kinase Etk

AA Sequence

MADREGGCAAGRGRELEPELEPGPGPGSALEPGEEFEIVDRSQLPGPGDLRSATRPRAAEGWSAPILTLA      1 - 70
RRATGNLSASCGSALRAAAGLGGGDSGDGTARAASKCQMMEERANLMHMMKLSIKVLLQSALSLGRSLDA     71 - 140
DHAPLQQFFVVMEHCLKHGLKVKKSFIGQNKSFFGPLELVEKLCPEASDIATSVRNLPELKTAVGRGRAW    141 - 210
LYLALMQKKLADYLKVLIDNKHLLSEFYEPEALMMEEEGMVIVGLLVGLNVLDANLCLKGEDLDSQVGVI    211 - 280
DFSLYLKDVQDLDGGKEHERITDVLDQKNYVEELNRHLSCTVGDLQTKIDGLEKTNSKLQEELSAATDRI    281 - 350
CSLQEEQQQLREQNELIRERSEKSVEITKQDTKVELETYKQTRQGLDEMYSDVWKQLKEEKKVRLELEKE    351 - 420
LELQIGMKTEMEIAMKLLEKDTHEKQDTLVALRQQLEEVKAINLQMFHKAQNAESSLQQKNEAITSFEGK    421 - 490
TNQVMSSMKQMEERLQHSERARQGAEERSHKLQQELGGRIGALQLQLSQLHEQCSSLEKELKSEKEQRQA    491 - 560
LQRELQHEKDTSSLLRMELQQVEGLKKELRELQDEKAELQKICEEQEQALQEMGLHLSQSKLKMEDIKEV    561 - 630
NQALKGHAWLKDDEATHCRQCEKEFSISRRKHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDSCHTLLL    631 - 700
QRCSSTAS                                                                  701 - 708
//

Text Mined References (18)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23144738 2012 AP-3 and Rabip4' coordinately regulate spatial distribution of lysosomes.
22911880 2012 Genome-wide association analysis of eating disorder-related symptoms, behaviors, and personality traits.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21269460 2011 Initial characterization of the human central proteome.
20534812 2010 Functional cross-talk between Rab14 and Rab4 through a dual effector, RUFY1/Rabip4.
19296456 2009 Membrane insertion of the FYVE domain is modulated by pH.
17233583 2007 Evolutionarily conserved structural and functional roles of the FYVE domain.
More...