Property Summary

NCBI Gene PubMed Count 25
Grant Count 38
R01 Count 8
Funding $2,803,586.76
PubMed Score 64.79
PubTator Score 16.88

Knowledge Summary

Patent

No data available

Expression

Gene RIF (11)

PMID Text
26575292 The authors demonstrate that RBM15 is methylated by protein arginine methyltransferase 1 (PRMT1) at residue R578, leading to its degradation via ubiquitylation by an E3 ligase (CNOT4).
25468569 OTT1 regulates the alternative splicing of Mpl-TR, a truncated isoform of c-Mpl, which modulates Thrombopoietin-mediated signaling.
22927943 both Rbm15 and the leukemogenic Rbm15-Mkl1 fusion protein interact with the Setd1b histone H3-Lys4 methyltransferase
22497198 RBM15 does indeed play a critical role in the survival of chronic myelogenous leukemia (CML) cells, which may have potential application in designing molecular therapies for CML treatment.
22174317 NXF1 upregulates the RBM15-mediated Gag expression from pNLgag-RTE, suggesting cooperation between RBM15 and NXF1
21370421 A four-way variant translocation originating the RBM15-MKL1 fusion gene is associated with acute megakaryoblastic leukemia.
21106733 HHV-8 ORF57 interacts with RBM15 and OTT3 to promote expression of viral intronless genes.
19586903 NXF1 upregulates the RBM15-mediated Gag expression from pNLgag-RTE, suggesting cooperation between RBM15 and NXF1
18710951 The deregulated activation of MAL-dependent and -independent promoters results in tissue-specific functions of OTT-MAL.[OTT-MAL]
18667423 functional and spatial changes of OTT and BSAC caused by the fusion might perturb their functions, culminating in the development of acute megakaryoblastic leukemia.
More...

AA Sequence

MRTAGRDPVPRRSPRWRRAVPLCETSAGRRVTQLRGDDLRRPATMKGKERSPVKAKRSRGGEDSTSRGER      1 - 70
SKKLGGSGGSNGSSSGKTDSGGGSRRSLHLDKSSSRGGSREYDTGGGSSSSRLHSYSSPSTKNSSGGGES     71 - 140
RSSSRGGGGESRSSGAASSAPGGGDGAEYKTLKISELGSQLSDEAVEDGLFHEFKRFGDVSVKISHLSGS    141 - 210
GSGDERVAFVNFRRPEDARAAKHARGRLVLYDRPLKIEAVYVSRRRSRSPLDKDTYPPSASVVGASVGGH    211 - 280
RHPPGGGGGQRSLSPGGAALGYRDYRLQQLALGRLPPPPPPPLPRDLERERDYPFYERVRPAYSLEPRVG    281 - 350
AGAGAAPFREVDEISPEDDQRANRTLFLGNLDITVTESDLRRAFDRFGVITEVDIKRPSRGQTSTYGFLK    351 - 420
FENLDMSHRAKLAMSGKIIIRNPIKIGYGKATPTTRLWVGGLGPWVPLAALAREFDRFGTIRTIDYRKGD    421 - 490
SWAYIQYESLDAAHAAWTHMRGFPLGGPDRRLRVDFADTEHRYQQQYLQPLPLTHYELVTDAFGHRAPDP    491 - 560
LRGARDRTPPLLYRDRDRDLYPDSDWVPPPPPVRERSTRTAATSVPAYEPLDSLDRRRDGWSLDRDRGDR    561 - 630
DLPSSRDQPRKRRLPEESGGRHLDRSPESDRPRKRHCAPSPDRSPELSSSRDRYNSDNDRSSRLLLERPS    631 - 700
PIRDRRGSLEKSQGDKRDRKNSASAERDRKHRTTAPTEGKSPLKKEDRSDGSAPSTSTASSKLKSPSQKQ    701 - 770
DGGTAPVASASPKLCLAWQGMLLLKNSNFPSNMHLLQGDLQVASSLLVEGSTGGKVAQLKITQRLRLDQP    771 - 840
KLDEVTRRIKVAGPNGYAILLAVPGSSDSRSSSSSAASDTATSTQRPLRNLVSYLKQKQAAGVISLPVGG    841 - 910
NKDKENTGVLHAFPPCEFSQQFLDSPAKALAKSEEDYLVMIIVRGFGFQIGVRYENKKRENLALTLL       911 - 977
//

Text Mined References (38)

PMID Year Title
26575292 2015 Cross-talk between PRMT1-mediated methylation and ubiquitylation on RBM15 controls RNA splicing.
25468569 2015 Ott1 (Rbm15) regulates thrombopoietin response in hematopoietic stem cells through alternative splicing of c-Mpl.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24100041 2013 Identification of Wilms' tumor 1-associating protein complex and its role in alternative splicing and the cell cycle.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22927943 2012 Rbm15-Mkl1 interacts with the Setd1b histone H3-Lys4 methyltransferase via a SPOC domain that is required for cytokine-independent proliferation.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22497198 2012 Biological effects of decreasing RBM15 on chronic myelogenous leukemia cells.
More...