Property Summary

NCBI Gene PubMed Count 25
PubMed Score 64.79
PubTator Score 16.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
medulloblastoma, large-cell 6234 1.70639486823092E-6
osteosarcoma 7933 6.42124030591193E-6
dermatomyositis 967 2.01476687660711E-4
ovarian cancer 8492 0.00156515890329998
Multiple myeloma 1328 0.00606456089148647
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00657932080431898
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00860569900459116
Waldenstrons macroglobulinemia 765 0.0168604512163946
Breast cancer 3099 0.0260219833290876
subependymal giant cell astrocytoma 2287 0.0412128680756402
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0431564077153457
Disease Target Count Z-score Confidence
Cancer 2346 3.056 1.5
Disease Target Count Z-score Confidence
Microcystic adenoma 3 3.182 1.6

Expression

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA Inparanoid
Cow OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (11)

PMID Text
26575292 The authors demonstrate that RBM15 is methylated by protein arginine methyltransferase 1 (PRMT1) at residue R578, leading to its degradation via ubiquitylation by an E3 ligase (CNOT4).
25468569 OTT1 regulates the alternative splicing of Mpl-TR, a truncated isoform of c-Mpl, which modulates Thrombopoietin-mediated signaling.
22927943 both Rbm15 and the leukemogenic Rbm15-Mkl1 fusion protein interact with the Setd1b histone H3-Lys4 methyltransferase
22497198 RBM15 does indeed play a critical role in the survival of chronic myelogenous leukemia (CML) cells, which may have potential application in designing molecular therapies for CML treatment.
22174317 NXF1 upregulates the RBM15-mediated Gag expression from pNLgag-RTE, suggesting cooperation between RBM15 and NXF1
21370421 A four-way variant translocation originating the RBM15-MKL1 fusion gene is associated with acute megakaryoblastic leukemia.
21106733 HHV-8 ORF57 interacts with RBM15 and OTT3 to promote expression of viral intronless genes.
19586903 NXF1 upregulates the RBM15-mediated Gag expression from pNLgag-RTE, suggesting cooperation between RBM15 and NXF1
18710951 The deregulated activation of MAL-dependent and -independent promoters results in tissue-specific functions of OTT-MAL.[OTT-MAL]
18667423 functional and spatial changes of OTT and BSAC caused by the fusion might perturb their functions, culminating in the development of acute megakaryoblastic leukemia.
More...

AA Sequence

MRTAGRDPVPRRSPRWRRAVPLCETSAGRRVTQLRGDDLRRPATMKGKERSPVKAKRSRGGEDSTSRGER      1 - 70
SKKLGGSGGSNGSSSGKTDSGGGSRRSLHLDKSSSRGGSREYDTGGGSSSSRLHSYSSPSTKNSSGGGES     71 - 140
RSSSRGGGGESRSSGAASSAPGGGDGAEYKTLKISELGSQLSDEAVEDGLFHEFKRFGDVSVKISHLSGS    141 - 210
GSGDERVAFVNFRRPEDARAAKHARGRLVLYDRPLKIEAVYVSRRRSRSPLDKDTYPPSASVVGASVGGH    211 - 280
RHPPGGGGGQRSLSPGGAALGYRDYRLQQLALGRLPPPPPPPLPRDLERERDYPFYERVRPAYSLEPRVG    281 - 350
AGAGAAPFREVDEISPEDDQRANRTLFLGNLDITVTESDLRRAFDRFGVITEVDIKRPSRGQTSTYGFLK    351 - 420
FENLDMSHRAKLAMSGKIIIRNPIKIGYGKATPTTRLWVGGLGPWVPLAALAREFDRFGTIRTIDYRKGD    421 - 490
SWAYIQYESLDAAHAAWTHMRGFPLGGPDRRLRVDFADTEHRYQQQYLQPLPLTHYELVTDAFGHRAPDP    491 - 560
LRGARDRTPPLLYRDRDRDLYPDSDWVPPPPPVRERSTRTAATSVPAYEPLDSLDRRRDGWSLDRDRGDR    561 - 630
DLPSSRDQPRKRRLPEESGGRHLDRSPESDRPRKRHCAPSPDRSPELSSSRDRYNSDNDRSSRLLLERPS    631 - 700
PIRDRRGSLEKSQGDKRDRKNSASAERDRKHRTTAPTEGKSPLKKEDRSDGSAPSTSTASSKLKSPSQKQ    701 - 770
DGGTAPVASASPKLCLAWQGMLLLKNSNFPSNMHLLQGDLQVASSLLVEGSTGGKVAQLKITQRLRLDQP    771 - 840
KLDEVTRRIKVAGPNGYAILLAVPGSSDSRSSSSSAASDTATSTQRPLRNLVSYLKQKQAAGVISLPVGG    841 - 910
NKDKENTGVLHAFPPCEFSQQFLDSPAKALAKSEEDYLVMIIVRGFGFQIGVRYENKKRENLALTLL       911 - 977
//

Text Mined References (38)

PMID Year Title
26575292 2015 Cross-talk between PRMT1-mediated methylation and ubiquitylation on RBM15 controls RNA splicing.
25468569 2015 Ott1 (Rbm15) regulates thrombopoietin response in hematopoietic stem cells through alternative splicing of c-Mpl.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24100041 2013 Identification of Wilms' tumor 1-associating protein complex and its role in alternative splicing and the cell cycle.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22927943 2012 Rbm15-Mkl1 interacts with the Setd1b histone H3-Lys4 methyltransferase via a SPOC domain that is required for cytokine-independent proliferation.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22497198 2012 Biological effects of decreasing RBM15 on chronic myelogenous leukemia cells.
More...