Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.98
PubTator Score 2.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Synonym

Accession Q96ST8 B9EGA6 Q8N5J8 Cep89
Symbols CEP123
CCDC123

Gene

Gene RIF (1)

PMID Text
23575228 CEP89 proteins play an important role in mitochondrial metabolism, especially complex IV activity, and are required for neuronal and cognitive function across evolution.

AA Sequence

MLLGFRRGRRSHFKHIIHGLLPAASVAPKAAVPRTPPPRSPNPSPERPRSALAAAILATTLTGRTVAIPQ      1 - 70
PRQRSRSESDVSSVEQDSFIEPYATTSQLRPRPNWQSEMGRRSSLPSFETLDYGDEEDIETQLSSSGKEL     71 - 140
GDVSAREDRGGHSDDLYAVPHRNQVPLLHEVNSEDDENISHQDGFPGSPPAPQRTQQKDGKHPVLNLKDE    141 - 210
KPPLCEKPPPSPDITGRARQRYTEITREKFEALKEENMDLNNMNQSLTLELNTMKQAMKELQLKLKGMEK    211 - 280
EKRKLKEAEKASSQEVAAPELLYLRKQAQELVDENDGLKMTVHRLNVELSRYQTKFRHLSKEESLNIEGL    281 - 350
PSKGPIPPWLLDIKYLSPLLLAYEDMMKEKDELNATLKEEMRMFRMRVQEVVKENEELHQELNKSSAVTS    351 - 420
EEWRQLQTQAKLVLEENKLLLEQLEIQQRKAKDSHQERLQEVSKLTKQLMLLEAKTHGQEKELAENREQL    421 - 490
EILRAKCQELKTHSDGKIAVEVHKSIVNELKSQLQKEEEKERAEMEELMEKLTVLQAQKKSLLLEKNSLT    491 - 560
EQNKALEAELERAQKINRKSQKKIEVLKKQVEKAMGNEMSAHQYLANLVGLAENITQERDSLMCLAKCLE    561 - 630
SEKDGVLNKVIKSNIRLGKLEEKVKGYKKQAALKLGDISHRLLEQQEDFAGKTAQYRQEMRHLHQVLKDK    631 - 700
QEVLDQALQQNREMEGELEVIWESTFRENRRIRELLQDTLTRTGVQDNPRALVAPSLNGVSQADLLDGCD    701 - 770
VCSYDLKSHAPTC                                                             771 - 783
//

Text Mined References (13)

PMID Year Title
23789104 2013 Primary ciliogenesis requires the distal appendage component Cep123.
23575228 2013 CEP89 is required for mitochondrial metabolism and neuronal function in man and fly.
23348840 2013 Centriole distal appendages promote membrane docking, leading to cilia initiation.
21976302 2011 Assessing the localization of centrosomal proteins by PALM/STORM nanoscopy.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
20383145 2010 Genetic loci influencing kidney function and chronic kidney disease.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16395595 2006 Human-specific nonsense mutations identified by genome sequence comparisons.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...