Property Summary

NCBI Gene PubMed Count 10
Grant Count 7
R01 Count 6
Funding $686,291
PubMed Score 3.69
PubTator Score 63.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
lung carcinoma 2,844
osteosarcoma 7,933

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.637 0.000
lung carcinoma 1.800 0.000

Gene RIF (5)

PMID Text
25319049 Data suggests that zinc finger protein 382 (ZNF382) may be considered a putative tumor suppressor gene in pediatric acute myeloid leukemia (AML).
25009298 Methylation changes of GFRA1, SRF, and ZNF382 may be a potential biomarker set for prediction of gastric carcinoma metastasis.
21876767 Expression of MAGE I proteins, MAGE-A3 or MAGE-C2, relieved repression of a reporter gene by ZNF382 and MAGE I expression relieved KAP1 mediated ID1 repression.
20682794 ZNF382 is a functional tumor suppressor frequently methylated in multiple carcinomas.
12459182 mapped to chromosome 19q13.13; transcript specific for ZNF382 is expressed at very early embryonic stage; at the adult stage, ZNF382 expression is restricted largely to heart tissue

AA Sequence

MPLQGSVSFKDVTVDFTQEEWQQLDPAQKALYRDVMLENYCHFVSVGFHMAKPDMIRKLEQGEELWTQRI      1 - 70
FPSYSYLEEDGKTEDVLVKFKEYQDRHSRPLIFINHKKLIKERSNIYGKTFTLGKNRISKTILCEYKPDG     71 - 140
KVLKNISELVIRNISPIKEKFGDSTGWEKSLLNTKHEKIHPAVNLHKQTERVLSGKQELIQHQKVQAPEQ    141 - 210
PFDHNECEKSFLMKGMLFTHTRAHRGERTFEYNKDGIAFIEKSSLSVHPSNLMEKKPSAYNKYGKFLCRK    211 - 280
PVFIMPQRPQTEEKPFHCPYCGNNFRRKSYLIEHQRIHTGEKPYVCNQCGKAFRQKTALTLHEKTHIEGK    281 - 350
PFICIDCGKSFRQKATLTRHHKTHTGEKAYECPQCGSAFRKKSYLIDHQRTHTGEKPYQCNECGKAFIQK    351 - 420
TTLTVHQRTHTGEKPYICNECGKSFCQKTTLTLHQRIHTGEKPYICNECGKSFRQKAILTVHHRIHTGEK    421 - 490
SNGCPQCGKAFSRKSNLIRHQKTHTGEKPYECKQCGKFFSCKSNLIVHQKTHKVETTGIQ              491 - 550
//

Text Mined References (13)

PMID Year Title
25319049 2014 Zinc finger protein 382 is downregulated by promoter hypermethylation in pediatric acute myeloid leukemia patients.
25009298 2014 Large-scale characterization of DNA methylation changes in human gastric carcinomas with and without metastasis.
21876767 2011 MAGE I transcription factors regulate KAP1 and KRAB domain zinc finger transcription factor mediated gene repression.
20682794 2010 KRAB zinc finger protein ZNF382 is a proapoptotic tumor suppressor that represses multiple oncogenes and is commonly silenced in multiple carcinomas.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14519192 2003 KRAB-containing zinc-finger repressor proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...