Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.03
PubTator Score 1.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma 1.200 3.0e-03
colon cancer 2.000 2.5e-02
glioblastoma 1.300 5.7e-08
group 3 medulloblastoma 1.400 5.5e-03
lung cancer 2.000 2.4e-03
osteosarcoma -1.421 8.1e-04
ovarian cancer 1.500 5.5e-03
posterior fossa group A ependymoma 1.100 1.8e-05
primitive neuroectodermal tumor 1.200 3.1e-04
ulcerative colitis -1.300 8.0e-05

Gene RIF (2)

AA Sequence

MMQGEAHPSASLIDRTIKMRKETEARKVVLAWGLLNVSMAGMIYTEMTGKLISSYYNVTYWPLWYIELAL      1 - 70
ASLFSLNALFDFWRYFKYTVAPTSLVVSPGQQTLLGLKTAVVQTTPPHDLAATQIPPAPPSPSIQGQSVL     71 - 140
SYSPSRSPSTSPKFTTSCMTGYSPQLQGLSSGGSGSYSPGVTYSPVSGYNKLASFSPSPPSPYPTTVGPV    141 - 210
ESSGLRSRYRSSPTVYNSPTDKEDYMTDLRTLDTFLRSEEEKQHRVKLGSPDSTSPSSSPTFWNYSRSMG    211 - 280
DYAQTLKKFQYQLACRSQAPCANKDEADLSSKQAAEEVWARVAMNRQLLDHMDSWTAKFRNWINETILVP    281 - 350
LVQEIESVSTQMRRMGCPELQIGEASITSLKQAALVKAPLIPTLNTIVQYLDLTPNQEYLFERIKELSQG    351 - 420
GCMSSFRWNRGGDFKGRKWDTDLPTDSAIIMHVFCTYLDSRLPPHPKYPDGKTFTSQHFVQTPNKPDVTN    421 - 490
ENVFCIYQSAINPPHYELIYQRHVYNLPKGRNNMFHTLLMFLYIIKTKESGMLGRVNLGLSGVNILWIFG    491 - 560
E//

Text Mined References (14)

PMID Year Title