Property Summary

NCBI Gene PubMed Count 35
PubMed Score 11.66
PubTator Score 7.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
active Crohn's disease -1.244 5.0e-03
adult high grade glioma -1.100 1.7e-03
cystic fibrosis -1.108 1.6e-03
ductal carcinoma in situ 1.100 4.3e-04
group 3 medulloblastoma 1.400 4.4e-03
invasive ductal carcinoma 1.200 3.7e-02
malignant mesothelioma 4.200 4.0e-09
ovarian cancer -1.500 1.7e-04
psoriasis 1.200 1.9e-06
tuberculosis 1.100 5.2e-05
X-linked cerebral adrenoleukodystrophy 2.000 2.7e-02

Gene RIF (21)

AA Sequence

MPHRKERPSGSSLHTHGSTGTAEGGNMSRLSLTRSPVSPLAAQGIPLPAQLTKSNAPVHIDVGGHMYTSS      1 - 70
LATLTKYPDSRISRLFNGTEPIVLDSLKQHYFIDRDGEIFRYVLSFLRTSKLLLPDDFKDFSLLYEEARY     71 - 140
YQLQPMVRELERWQQEQEQRRRSRACDCLVVRVTPDLGERIALSGEKALIEEVFPETGDVMCNSVNAGWN    141 - 210
QDPTHVIRFPLNGYCRLNSVQVLERLFQRGFSVAASCGGGVDSSQFSEYVLCREERRPQPTPTAVRIKQE    211 - 280
PLD                                                                       281 - 283
//

Text Mined References (40)

PMID Year Title