Property Summary

NCBI Gene PubMed Count 34
Grant Count 10
Funding $961,598.65
PubMed Score 10.62
PubTator Score 7.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 4.200 0.000
medulloblastoma 1.600 0.000
cystic fibrosis 1.400 0.000
tuberculosis and treatment for 3 months 2.300 0.000
X-linked cerebral adrenoleukodystrophy 2.900 0.013
active Crohn's disease -1.500 0.016
adult high grade glioma -1.100 0.002
psoriasis 1.200 0.000
ductal carcinoma in situ 1.800 0.000
invasive ductal carcinoma 1.200 0.037
ovarian cancer 1.800 0.003

Gene RIF (21)

PMID Text
25637721 SEC16B, MC4R, MAP2K5 and KCTD15 (rs17782313, rs543874, rs2241423 and rs11084753) polymorphisms are associated with the risk for children obesity in China.
24086424 These data suggest that the non-SUMOylated form of Kctd15 functions in neural crest development.
23382213 results indicate that Kctd15 acts in the embryo at least in part by specifically binding to the activation domain of AP-2alpha, thereby blocking the function of this critical factor in the neural crest induction hierarchy.
23121087 Data show the synthetic effect of SNPs on the indices of adiposity and risk of obesity in Chinese girls, but failed to replicate the effect of five separate variants of SEC16B rs10913469, SH2B1 rs4788102, PCSK1 rs6235, KCTD15 rs29941 and BAT2 rs2844479.
20816195 Observational study of gene-disease association. (HuGE Navigator)
20816152 Observational study of gene-disease association. (HuGE Navigator)
20725061 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20724581 Observational study of gene-disease association. (HuGE Navigator)
20712903 Observational study of gene-disease association. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
More...

AA Sequence

MPHRKERPSGSSLHTHGSTGTAEGGNMSRLSLTRSPVSPLAAQGIPLPAQLTKSNAPVHIDVGGHMYTSS      1 - 70
LATLTKYPDSRISRLFNGTEPIVLDSLKQHYFIDRDGEIFRYVLSFLRTSKLLLPDDFKDFSLLYEEARY     71 - 140
YQLQPMVRELERWQQEQEQRRRSRACDCLVVRVTPDLGERIALSGEKALIEEVFPETGDVMCNSVNAGWN    141 - 210
QDPTHVIRFPLNGYCRLNSVQVLERLFQRGFSVAASCGGGVDSSQFSEYVLCREERRPQPTPTAVRIKQE    211 - 280
PLD                                                                       281 - 283
//

Text Mined References (39)

PMID Year Title
25637721 2015 Genetic variations in SEC16B, MC4R, MAP2K5 and KCTD15 were associated with childhood obesity and interacted with dietary behaviors in Chinese school-age population.
25416956 2014 A proteome-scale map of the human interactome network.
24086424 2013 The BTB-containing protein Kctd15 is SUMOylated in vivo.
23382213 2013 Inhibition of neural crest formation by Kctd15 involves regulation of transcription factor AP-2.
23377640 2013 Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23121087 2013 Sex-dependent associations of genetic variants identified by GWAS with indices of adiposity and obesity risk in a Chinese children population.
21269460 2011 Initial characterization of the human central proteome.
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
More...