Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.17
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2843 2.8e-19
ovarian cancer 8520 4.5e-08
osteosarcoma 7950 1.2e-04
oligodendroglioma 2850 3.8e-03
ependymoma 4679 4.5e-03
astrocytic glioma 2597 9.4e-03
Disease Target Count Z-score Confidence
Diphtheria 40 3.341 1.7

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma -1.400 9.4e-03
ependymoma -1.900 4.5e-03
lung carcinoma 1.100 2.8e-19
oligodendroglioma -1.600 3.8e-03
osteosarcoma -1.865 1.2e-04
ovarian cancer 1.100 4.5e-08

AA Sequence

MASPSRQPPPGGSGLLQGSRARSYGSLVQSACSPVRERRLEHQLEPGDTLAGLALKYGVTMEQIKRANRL      1 - 70
YTNDSIFLKKTLYIPILTEPRDLFNGLDSEEEKDGEEKVHPSNSEVWPHSTERKKQETGAGRANGEVLPT     71 - 140
PGQETPTPIHDLSASDFLKKLDSQISLSKKAAAQKLKKGENGVPGEDAGLHLSSPWMQQRAVLGPVPLTR    141 - 210
TSRTRTLRDQEDEIFKL                                                         211 - 227
//

Text Mined References (12)

PMID Year Title