Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.52
PubTator Score 2.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Schizophrenia 1160
Disease Target Count P-value
psoriasis 6694 9.0e-66
ovarian cancer 8520 3.6e-07
interstitial cystitis 2312 4.9e-04
Disease Target Count Z-score Confidence
Syndromic X-linked intellectual disability Cabezas type 7 4.267 2.1

Expression

  Differential Expression (3)

Disease log2 FC p
interstitial cystitis 1.100 4.9e-04
ovarian cancer 1.200 3.6e-07
psoriasis 1.400 9.0e-66

Gene RIF (2)

AA Sequence

MGLLLLVPLLLLPGSYGLPFYNGFYYSNSANDQNLGNGHGKDLLNGVKLVVETPEETLFTYQGASVILPC      1 - 70
RYRYEPALVSPRRVRVKWWKLSENGAPEKDVLVAIGLRHRSFGDYQGRVHLRQDKEHDVSLEIQDLRLED     71 - 140
YGRYRCEVIDGLEDESGLVELELRGVVFPYQSPNGRYQFNFHEGQQVCAEQAAVVASFEQLFRAWEEGLD    141 - 210
WCNAGWLQDATVQYPIMLPRQPCGGPGLAPGVRSYGPRHRRLHRYDVFCFATALKGRVYYLEHPEKLTLT    211 - 280
EAREACQEDDATIAKVGQLFAAWKFHGLDRCDAGWLADGSVRYPVVHPHPNCGPPEPGVRSFGFPDPQSR    281 - 350
LYGVYCYRQH                                                                351 - 360
//

Text Mined References (9)

PMID Year Title