Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.53
PubTator Score 2.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 9.03160084147995E-66
ovarian cancer 8492 3.59214599592222E-7
interstitial cystitis 2299 4.91096913477618E-4

Expression

  Differential Expression (3)

Disease log2 FC p
interstitial cystitis 1.100 0.000
ovarian cancer 1.200 0.000
psoriasis 1.400 0.000

Synonym

Accession Q96S86 A8K7P0
Symbols EXLD1
HsT19883

Gene

  Ortholog (10)

Gene RIF (2)

PMID Text
20950796 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20664984 Elevated CLDN16 gene expression was suggested to be involved in the development of breast cancer and to be a biomarker and target treatment for breast cancer.

AA Sequence

MGLLLLVPLLLLPGSYGLPFYNGFYYSNSANDQNLGNGHGKDLLNGVKLVVETPEETLFTYQGASVILPC      1 - 70
RYRYEPALVSPRRVRVKWWKLSENGAPEKDVLVAIGLRHRSFGDYQGRVHLRQDKEHDVSLEIQDLRLED     71 - 140
YGRYRCEVIDGLEDESGLVELELRGVVFPYQSPNGRYQFNFHEGQQVCAEQAAVVASFEQLFRAWEEGLD    141 - 210
WCNAGWLQDATVQYPIMLPRQPCGGPGLAPGVRSYGPRHRRLHRYDVFCFATALKGRVYYLEHPEKLTLT    211 - 280
EAREACQEDDATIAKVGQLFAAWKFHGLDRCDAGWLADGSVRYPVVHPHPNCGPPEPGVRSFGFPDPQSR    281 - 350
LYGVYCYRQH                                                                351 - 360
//

Text Mined References (9)

PMID Year Title
20950796 2011 Candidate gene analysis of the human natural killer-1 carbohydrate pathway and perineuronal nets in schizophrenia: B3GAT2 is associated with disease risk and cortical surface area.
20664984 2010 Significant elevation of CLDN16 and HAPLN3 gene expression in human breast cancer.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12663660 2003 A hyaluronan binding link protein gene family whose members are physically linked adjacent to chondroitin sulfate proteoglycan core protein genes: the missing links.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.